KEGG   Sulfurimonas denitrificans: Suden_1681Help
Entry
Suden_1681        CDS       T00298                                 

Definition
tryptophan synthase (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Suden_1681
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Suden_1681
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Suden_1681
Enzymes [BR:tdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Suden_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1763240..1763980
Genome map
AA seq 246 aa AA seqDB search
MKKLVAYITSGYPEKSFSIDLALALSQSGVDTLELGVPFSDPVADGPLIELANQKALEFG
FRFKDLIEISKEIAPKVDTLWMGYFNSFYQQNMQKLLPFAKEIGLSGFIIPDLPHEESVV
FNDLFNANALSNISFVAPTDTNERIEQLVKDSKKFIYMVAYTGITGSGKAEDLQPILSNI
KKHTQTPIYVGFGVNKKTAKDKVKGADGVIVGSAFVEILLDKTLSYTEKIDNCSELAKIL
KGEINS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaattagtagcatatattacatctggttatccagaaaaatctttcagtattgat
ttagcattagcactaagtcaaagtggtgttgatacacttgaacttggagtgccattttca
gacccagtagcagatggtcctttgatagagttggcaaatcagaaggcacttgagtttgga
tttagatttaaagatcttatagaaatttctaaagaaattgcacctaaagtagatactcta
tggatgggatattttaatagtttttatcaacaaaatatgcaaaagctactcccttttgca
aaagagattgggttaagtggatttattatcccagatttaccacatgaagagagcgttgtg
tttaatgatttatttaatgcaaatgcactctcaaatataagctttgtagcaccgacagac
accaatgagagaattgagcagctagttaaagattctaaaaaatttatctacatggtcgct
tatacaggtataacgggttcaggcaaagcagaagatttacaacctatcttatcaaatata
aaaaagcatacacaaactcctatttatgtaggttttggagtaaataaaaaaacggctaaa
gataaagtaaaaggtgcagatggtgtaatagtaggaagtgcttttgtagagatactttta
gacaaaactttgagctatacagagaaaatagataactgtagtgaacttgctaaaatttta
aaaggtgagataaatagttga

DBGET integrated database retrieval system