KEGG   Sulfurimonas denitrificans: Suden_1681Help
Entry
Suden_1681        CDS       T00298                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00260  Glycine, serine and threonine metabolism
tdn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tdn01100  Metabolic pathways
tdn01110  Biosynthesis of secondary metabolites
tdn01130  Biosynthesis of antibiotics
tdn01230  Biosynthesis of amino acids
Module
tdn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Suden_1681
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Suden_1681
Enzymes [BR:tdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Suden_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB His_biosynth T2SSE
Motif
Other DBs
NCBI-ProteinID: ABB44958
JGI: Tmden1681
UniProt: Q30PX3
Position
1763240..1763980
Genome map
AA seq 246 aa AA seqDB search
MKKLVAYITSGYPEKSFSIDLALALSQSGVDTLELGVPFSDPVADGPLIELANQKALEFG
FRFKDLIEISKEIAPKVDTLWMGYFNSFYQQNMQKLLPFAKEIGLSGFIIPDLPHEESVV
FNDLFNANALSNISFVAPTDTNERIEQLVKDSKKFIYMVAYTGITGSGKAEDLQPILSNI
KKHTQTPIYVGFGVNKKTAKDKVKGADGVIVGSAFVEILLDKTLSYTEKIDNCSELAKIL
KGEINS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaattagtagcatatattacatctggttatccagaaaaatctttcagtattgat
ttagcattagcactaagtcaaagtggtgttgatacacttgaacttggagtgccattttca
gacccagtagcagatggtcctttgatagagttggcaaatcagaaggcacttgagtttgga
tttagatttaaagatcttatagaaatttctaaagaaattgcacctaaagtagatactcta
tggatgggatattttaatagtttttatcaacaaaatatgcaaaagctactcccttttgca
aaagagattgggttaagtggatttattatcccagatttaccacatgaagagagcgttgtg
tttaatgatttatttaatgcaaatgcactctcaaatataagctttgtagcaccgacagac
accaatgagagaattgagcagctagttaaagattctaaaaaatttatctacatggtcgct
tatacaggtataacgggttcaggcaaagcagaagatttacaacctatcttatcaaatata
aaaaagcatacacaaactcctatttatgtaggttttggagtaaataaaaaaacggctaaa
gataaagtaaaaggtgcagatggtgtaatagtaggaagtgcttttgtagagatactttta
gacaaaactttgagctatacagagaaaatagataactgtagtgaacttgctaaaatttta
aaaggtgagataaatagttga

DBGET integrated database retrieval system