KEGG   Sulfurimonas denitrificans: Suden_1681Help
Entry
Suden_1681        CDS       T00298                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Suden_1681
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Suden_1681
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Suden_1681
Enzymes [BR:tdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Suden_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1763240..1763980
Genome map
AA seq 246 aa AA seqDB search
MKKLVAYITSGYPEKSFSIDLALALSQSGVDTLELGVPFSDPVADGPLIELANQKALEFG
FRFKDLIEISKEIAPKVDTLWMGYFNSFYQQNMQKLLPFAKEIGLSGFIIPDLPHEESVV
FNDLFNANALSNISFVAPTDTNERIEQLVKDSKKFIYMVAYTGITGSGKAEDLQPILSNI
KKHTQTPIYVGFGVNKKTAKDKVKGADGVIVGSAFVEILLDKTLSYTEKIDNCSELAKIL
KGEINS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaattagtagcatatattacatctggttatccagaaaaatctttcagtattgat
ttagcattagcactaagtcaaagtggtgttgatacacttgaacttggagtgccattttca
gacccagtagcagatggtcctttgatagagttggcaaatcagaaggcacttgagtttgga
tttagatttaaagatcttatagaaatttctaaagaaattgcacctaaagtagatactcta
tggatgggatattttaatagtttttatcaacaaaatatgcaaaagctactcccttttgca
aaagagattgggttaagtggatttattatcccagatttaccacatgaagagagcgttgtg
tttaatgatttatttaatgcaaatgcactctcaaatataagctttgtagcaccgacagac
accaatgagagaattgagcagctagttaaagattctaaaaaatttatctacatggtcgct
tatacaggtataacgggttcaggcaaagcagaagatttacaacctatcttatcaaatata
aaaaagcatacacaaactcctatttatgtaggttttggagtaaataaaaaaacggctaaa
gataaagtaaaaggtgcagatggtgtaatagtaggaagtgcttttgtagagatactttta
gacaaaactttgagctatacagagaaaatagataactgtagtgaacttgctaaaatttta
aaaggtgagataaatagttga

DBGET integrated database retrieval system