KEGG   Sulfurimonas denitrificans: Suden_1684Help
Entry
Suden_1684        CDS       T00298                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Suden_1684
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Suden_1684
Enzymes [BR:tdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Suden_1684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1764788..1765555
Genome map
AA seq 255 aa AA seqDB search
MNRIVIKVGTAVLTQDNNIAKERMLNLVTLIAKLRERYDVVLVTSGAVAAGYSALKLDKR
KQIGKKALAAAGQPILMTAYKKKFDIYDITTAQILLTEDDFDSRKRTKMFQEIIDAHLEN
GILPIVNENDITSTPEQLFGDNDQLSANVAHAVESELLVILSDIDGYYDKNPQEFKDAKI
YKVVNEIPQNLLADISTPNNEFATGGIVTKLKAADFLIKNGRKMFLCNGFNLSAAESYLL
EGKHILGTLFEPKKS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattgttataaaagttggaacggcagttttaacgcaggacaataatattgcc
aaggagcgtatgctcaatcttgtaacattgattgccaaactaagagagaggtatgatgta
gttttggtgacatcaggagcggtcgctgctgggtactccgcacttaaattagataaaaga
aaacagattggaaaaaaagctttagcagcggctggtcagcctattctaatgacggcttat
aaaaagaaatttgatatttatgatatcacaacggcacaaattttactcacagaggatgat
tttgactcaagaaaaagaacaaaaatgtttcaagagattattgatgctcatttagaaaat
ggtattttgccaattgtaaatgagaatgatataacttctacccctgagcaactctttggc
gataatgatcagctctctgcaaatgttgcgcatgctgttgaatcagagttgctagttatt
cttagtgatattgatggctattatgataaaaatcctcaagagttcaaagatgctaaaatc
tataaagttgtaaatgaaatcccacaaaatctgctagctgatatatcaacaccaaacaat
gagtttgcaactggtgggatagtgacaaaactaaaagctgctgattttttgataaaaaac
ggacgcaaaatgtttttgtgtaatggattcaaccttagcgctgcagagtcgtatttactg
gaaggcaaacatatacttggaactctttttgagccaaaaaagagttga

DBGET integrated database retrieval system