KEGG   Sulfurimonas denitrificans: Suden_1770Help
Entry
Suden_1770        CDS       T00298                                 

Definition
nitrous-oxide reductase NosZ (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Suden_1770
Enzymes [BR:tdn01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Suden_1770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1852688..1855282
Genome map
AA seq 864 aa AA seqDB search
MKKYLQIVYGALLGVLVIVQSATAESEFQKVMQKRGLSEKDALAALKVYNPSGKHDEYYA
FVSGGQSGQVMVYGIPSMRILKYIAVFAPEPWQGYGFDTDSKEILRQGNIRGREINWGDT
HHPALSESDGKYDGKYLFINDKANARIAVIDLKYFETSQIVVNPIFKSSHGGAFVTPNTD
YILESCQYAAPFTNDYYPMEAYEEVYRGGVTFWKFDKKNGKISQQDSFTLELPPYMQDLT
DAGKGISDGWAFTNSFNSELYTGGIEKGLPPFEAGCSRNDMDYLHVYNWKKLAELVKDDK
NVKVINGHRVIPIEIAVKNNALFLIPENKSPHGVDVNPDGQYIIVSGKLDTHASVYDFKK
ILKQIENKEFASKDSYGIPILDIKKSLHGQLELGLGHLHNTFGKEDGTIYSSLYVDSQVV
KWNYKQLKLLDRTNIHYNVGHLEAMEGKSADPQGEYLIALNKLSIDRFLPVGPLHPQNNQ
LIDIGGKKMELLVDMPVPLGEPHQAASIRASKIHTEVRYNMGTNSKTLKPHVGKTLAGQE
RIERKGNHVYIYSTMVRSHINPEHITLNKGDKVTMYITNLERAQDETHGFTIDHHNIHAS
VEPGESVQLDFVADIEGVFPYYCTEFCSALHIEMLGYMLVKDPNKDYGWIQKTKIKGLSK
EELQKEYEKILANNEATNSVIDSLFKFFEDRGYAKYPTVKNLVDDAKDQYTKIDSEREKA
TKAYNEKNLENAVLFENMVWQYMIKTADSAIRAKDLLVTNLATKKSAGAKKGEEVFHEGG
CSGCHVVGRVSSGPDLIGVLKRHRNAEKWVAEYIKNPESKFKEPYMERLIKFFNLKMPNQ
NMKDEEIKDIIEYFKWIDENADLF
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaatatttgcagattgtttatggtgcacttttaggagtgttagttatagtgcaa
agtgcgactgctgagtcagagtttcaaaaagttatgcaaaagcgtggtcttagcgaaaaa
gacgcactcgctgcattaaaagtttataaccctagcggcaagcatgacgaatattatgct
tttgtcagcggaggacaatctggtcaagtgatggtttatggcatcccatctatgagaatt
ttaaaatatattgcagttttcgccccagaaccatggcaaggctatggttttgacactgat
tcaaaagagattttaagacaaggaaacatcagaggaagagagattaattggggagataca
caccatccagcgctctctgagagtgatggaaaatatgatggaaaatatctctttatcaac
gacaaggcaaatgcaagaattgctgtaattgatttaaaatactttgaaacttcacaaatc
gtagtaaatccaatcttcaaatcaagccacggaggcgcatttgtaactccaaatacagac
tatattcttgaatcttgccaatacgcagccccttttacaaatgattattatcctatggag
gcgtatgaagaggtttatcgaggtggagtaacgttttggaaatttgacaaaaaaaacgga
aaaatttcacagcaagactcttttactcttgaactccctccttatatgcaagatttaaca
gatgcaggcaaaggtatctcggatggatgggcatttacaaactcttttaattcagagctc
tatacaggaggcatagaaaaagggcttcctccttttgaagctggatgtagccgcaacgat
atggactacctacatgtatataactggaaaaaattagctgagcttgtaaaagatgacaaa
aatgttaaagtaataaatggacatagagtcatacccatagaaatagctgttaaaaacaac
gcacttttcttaattcctgaaaataaatctcctcatggagttgatgtaaacccagatgga
cagtacataatagtttcaggcaaactagatacccacgcatctgtttatgattttaagaag
attctaaagcagattgagaacaaagaatttgcctcaaaagatagttatggcataccaatt
ttagatattaaaaaatctctacatggacagttagaacttggacttgggcatctgcacaat
acatttggcaaggaagatggcacaatttatagctctttatatgttgattctcaagtcgta
aaatggaattacaaacagctaaaacttttagatagaacaaatatacactataacgttgga
caccttgaagcaatggagggcaaatctgctgaccctcaaggagagtatctcatcgctcta
aataaactctctattgatagatttttgcccgttggtccattacatccgcaaaataaccag
ctcatagatattggtggtaaaaaaatggaacttcttgttgatatgcctgttccacttgga
gagccacatcaagccgcttcaattagagcaagtaagattcatacggaagtcagatataac
atgggaactaattcaaagactctcaaaccacatgtaggaaaaactctcgctggacaagag
agaattgagagaaaaggaaatcatgtttatatctactccacaatggtacgctcacatata
aatcctgaacatattactcttaacaaaggagataaggttacgatgtatattaccaattta
gagcgtgctcaggatgagactcacggctttacaattgatcatcataacatccacgcctct
gtggaacctggagagagtgtccagttggactttgtagcagatattgaaggtgtctttcct
tactactgtacagaattttgctctgcacttcatattgaaatgcttggatatatgctagtt
aaagacccaaataaagattatgggtggattcaaaaaacaaaaatcaaaggactctccaag
gaggagttacaaaaagagtatgaaaaaatcttagcaaataatgaagcaaccaacagtgtt
atagattcactctttaaattttttgaagatagaggatatgcaaaatatcctactgtaaag
aatctagtagatgatgcaaaagatcaatataccaaaatagattctgagcgagaaaaagca
acaaaagcatacaacgaaaaaaatctcgaaaatgcagttctttttgaaaatatggtatgg
caatatatgattaaaaccgctgattctgctattagagctaaagatcttttggtcacaaat
ttagctacaaaaaaatcagcaggggcaaaaaaaggagaagaggtatttcatgaaggagga
tgttctggctgtcatgttgtcggtagagtcagctctggtcctgatttgataggtgttctt
aagcgacatagaaacgcagagaaatgggtcgcagagtatatcaaaaacccagagagtaaa
tttaaagaaccctacatggagagattgattaagtttttcaacctaaagatgccaaatcaa
aacatgaaagacgaagagattaaagatatcatagaatattttaaatggatagatgaaaat
gctgatttgttttga

DBGET integrated database retrieval system