KEGG   Sulfurimonas denitrificans: Suden_1939Help
Entry
Suden_1939        CDS       T00298                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:tdn02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:tdn02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2021598..2022179
Genome map
AA seq 193 aa AA seqDB search
MLENSQLERVILIGASTGGPGQIEKIIKALPKLKHTTIIIAQHMALDFIASFVKRLGEHS
SNSIHIIENALRLRAGEIYICQGITTIHSTNVGLEFHLTCSKEYKYNPDINALFSSFAPF
VKSYKTLGIILTGIGDDGVSGCKELSLMGARTITQTQESAIVDGMPLRARQSIESIEIDD
TNGIKNKIMEFCN
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgttagaaaattcacaactcgagagagttatcctcataggtgcttcaactggaggacca
ggtcagatagagaagataattaaagctctgccaaaactcaaacatacaaccatcataatc
gctcagcacatggcgcttgattttattgcaagttttgtaaaaaggttaggcgagcatagt
agtaacagcatacatattatagaaaatgctcttagattaagagcgggagagatatatatt
tgccaaggaatcaccacaattcatagcacaaatgtggggctggaatttcatcttacatgt
tcaaaagagtacaaatacaatcccgatataaacgctctctttagctcttttgcccctttt
gtaaagagttataaaacactaggcattatactaacaggaattggcgatgatggtgttagc
ggatgcaaagagttgtctttaatgggggctagaacaattacccaaacccaagagagcgcc
attgtagatggaatgccgcttcgggcaagacaatcaatagagtcaattgagatagatgac
actaatggtataaaaaataaaattatggagttttgtaactaa

DBGET integrated database retrieval system