KEGG   Sulfurimonas denitrificans: Suden_2086Help
Entry
Suden_2086        CDS       T00298                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00790  Folate biosynthesis
tdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Suden_2086
Enzymes [BR:tdn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Suden_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EIF_2_alpha DUF3638 Tim54 Spike_torovirin
Motif
Other DBs
NCBI-ProteinID: ABB45360
JGI: Tmden2086
UniProt: Q30NS1
Position
complement(2179150..2179689)
Genome map
AA seq 179 aa AA seqDB search
MMLHVGENPDREGLLKTPQRVKKAYEFIFGGYKEDPEEILNSALFTSSNDEMVLLKDIEF
YSTCEHHLLPIIGRVHVAYIPNGKVVGLSKIPRVVNVFARRMQIQEQLTEQIADAIMNTI
KPKGVAVVVQARHMCMEMRGVEKINSTTTSSALRGLFKKDEKTRSEFFSLINSPNGSRY
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttcatgtcggggaaaatccagacagagaagggcttttaaaaactcctcaaagg
gttaagaaagcttacgagttcatttttggtggttataaagaggacccagaagagatatta
aactctgctctttttacaagttcaaatgatgagatggtgcttctaaaagacattgaattt
tactctacatgtgagcatcatcttctaccaatcattgggcgtgtgcatgtagcgtatatt
ccaaatggtaaggttgtaggattatcaaaaatacctcgtgttgtaaacgtttttgctcgt
cgcatgcagattcaagagcaacttacagagcagattgctgatgctattatgaatactatt
aagccaaaaggtgtagcagttgtggttcaggcaagacacatgtgcatggagatgagaggg
gttgagaaaatcaattcaactactacatcttcagcccttcgcggattatttaaaaaagat
gaaaaaacaagaagtgaatttttctctttgataaactcgcctaatggctcacgttattaa

DBGET integrated database retrieval system