KEGG   Taylorella equigenitalis ATCC 35865: KUI_0244Help
Entry
KUI_0244          CDS       T02186                                 

Definition
putative disulfide bond isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tea  Taylorella equigenitalis ATCC 35865
Brite
Enzymes [BR:tea01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KUI_0244
Secretion system [BR:tea02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   KUI_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
248030..248896
Genome map
AA seq 288 aa AA seqDB search
MNNEVKVKFELNKLCGGLVLAFTAVTACVVSSVVVSADVVAQTASSVSQTTEKTKVPTTV
ESKSAGMKAGALPQDKVDNIKSNIEKTFQVKVLSVNPTPFADLYEVLTDETIIYTNADHN
YILAGHLIDAKSTVDLTDKRVKEQSAKAFASLPVEGAVKRVKGKGTRKLVTFEDPNCPYC
KALYKELEQMDDVTIYTFLVPLLAKDSVTKVRDIMCSSNPTLSWHEWVTDGKKPQSQANK
SCSEPNPKTFQLARSVNVQGVPVILFPNGERRNGFVRLADIEKIISSK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgaggtgaaagtgaaatttgaattaaataaattatgtggtggtctcgtgttg
gcatttactgctgtgactgcttgtgtcgtgtcatctgtggttgtgtcggcagatgtggtg
gctcagactgccagttccgtttctcaaactacagaaaagactaaagttcctacaactgtt
gaatctaaatctgcagggatgaaggcgggggcattgccacaagataaagtggacaatatt
aaatccaatatcgagaagacttttcaagttaaggttttaagcgtaaatccgactcctttt
gcggatttgtacgaagtattgacggatgagacgataatctatacaaatgcggatcataat
tatattttggcagggcatcttatcgacgctaagtcgacagttgatctgacggacaagcgt
gttaaagagcagtcagctaaggcatttgcaagcctgccagtggagggggctgttaagcgc
gtgaaaggaaaaggtacgcgtaaacttgtgacttttgaggacccgaattgcccatattgc
aaggctttatataaggagcttgagcagatggatgatgtcactatttatactttcttagtg
cccttattagcaaaggattctgtgactaaggtgcgggacattatgtgttcatcgaaccca
actctttcatggcacgagtgggttacagacggcaagaagccacaatctcaggctaataaa
agttgttctgagccaaaccctaaaacatttcagcttgctagaagcgttaatgtgcagggg
gtgccagtgattttatttcctaatggagaacgaagaaacggttttgttcgtttagcggat
attgaaaaaattatttcttctaagtaa

DBGET integrated database retrieval system