KEGG   Taylorella equigenitalis ATCC 35865: KUI_0267Help
Entry
KUI_0267          CDS       T02186                                 

Definition
hypothetical protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tea  Taylorella equigenitalis ATCC 35865
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(266290..266973)
Genome map
AA seq 227 aa AA seqDB search
MSSLNSLLEKSRINMILQQIKPAGVLDELVLNALLGLSREAFVAPEFVTVAYSDTSIPIV
VNGEPSGEHMLTPITEARIAQSLSLLPTDTCLEIGTGSGFQAALLSRLCTEVESVEINPN
IANFAMENLARNHISNVRVQIGDASSGWGTREYNAIAITGSCPKLPDALKYQLSVGGRLV
GFIGTPPVIEMKLITRMSASEFDEVNLTETVIEKLHGSAFVESEFIF
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcttaaattcacttctcgagaaaagccgcatcaatatgattctacagcagatt
aaacctgctggtgttttggatgagcttgtgcttaacgcacttttaggactttctcgagag
gcatttgtggcacctgaatttgtcacagttgcttattcagacactagcatacctatagta
gtaaacggagagccatctggcgagcacatgcttacaccaattacggaagctagaatcgca
cagtctctttcattacttcctaccgacacttgcttagagattggtactggtagcggattt
caagcagcacttctaagtcgcctatgtacagaagttgagtcagtagagataaatcctaat
attgcaaactttgcgatggagaacctagcacgtaatcatattagtaatgtacgtgtgcag
attggagatgcatcttctggatggggtacacgtgaatataacgcaatcgctattacaggt
tcttgccctaagttacctgatgccttgaagtatcagctttccgttggtggtcgattggtg
ggttttattgggactcctccagtaatcgagatgaagcttatcacccgtatgagtgcctct
gaatttgatgaagtgaacttaaccgaaaccgtaatagaaaaactgcacgggtcggctttc
gtagagtctgaatttattttttaa

DBGET integrated database retrieval system