KEGG   Taylorella equigenitalis ATCC 35865: KUI_0343Help
Entry
KUI_0343          CDS       T02186                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KUI_0343 (folA)
   00670 One carbon pool by folate
    KUI_0343 (folA)
Enzymes [BR:tea01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     KUI_0343 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
342032..342529
Genome map
AA seq 165 aa AA seqDB search
MPKICLIVAYSENHAIGLNGDMPWRLKGDLAYFKKTTMGCPIIMGRKTRDSLGRPLPGRI
NIAISRDADYFAEGTVVLPSLEQSLEYANNNSDASKIFIIGGGQIYKQALPVADKVYATE
IHKSFEADTFFPQLDKSQWTEVSRDPQPEENGLAYDFVVYEKKEF
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaatttgtcttatcgttgcatattctgaaaaccatgctattggtcttaacggt
gatatgccgtggaggcttaaaggtgaccttgcctatttcaaaaaaaccacaatggggtgt
cccattatcatgggtcgcaaaacgcgtgactcgctcggtaggccattgccaggcaggata
aatattgcaatttcacgggatgcagactattttgcagaggggacggtagtattgccatcc
ttagaacaatcgttggaatatgcaaataataattctgatgcctcgaaaatttttataata
ggaggtgggcagatttacaaacaggcattgcccgtagcggataaagtatacgcaactgaa
attcataagagtttcgaagcggatacattttttccacaacttgataaatcgcaatggacc
gaagtttcaagagatcctcagcctgaggaaaacggtcttgcgtacgatttcgtggtttac
gaaaagaaggagttttaa

DBGET integrated database retrieval system