KEGG   Taylorella equigenitalis ATCC 35865: KUI_0345Help
Entry
KUI_0345          CDS       T02186                                 

Definition
putative phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KUI_0345
   00030 Pentose phosphate pathway
    KUI_0345
   00051 Fructose and mannose metabolism
    KUI_0345
   00052 Galactose metabolism
    KUI_0345
   00500 Starch and sucrose metabolism
    KUI_0345
   00520 Amino sugar and nucleotide sugar metabolism
    KUI_0345
  Nucleotide metabolism
   00230 Purine metabolism
    KUI_0345
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KUI_0345
Enzymes [BR:tea01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     KUI_0345
    5.4.2.8  phosphomannomutase
     KUI_0345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(343850..345352)
Genome map
AA seq 500 aa AA seqDB search
MLITTIPLNVFKEYDIRGHYPDEINPQFAYLLGFALMEVLPPQNIGSVLIAHDAREGGPE
LAKALYNALKTRVKSEHIQFAGLEHPGLLAIHNIHKNYGLIIYITASHNPVGFNGFKIYC
DSLPIDSETIKLIAYNMKRLADADFKFLHYSEEIFEQPPIEEIENSEYINALLSEPDYCQ
EKYILKIAIDGGNGVAGLIARELYEKMGHEVLELNCIPDGAFPNHHPDPSVPDNLMQLRK
FVVEHGCDIGLAFDGDADRLGVVDYQGQIIGSDRVFIFLIREMMKFYKSYSDYDPAKPVH
IVYDIKSSRHIQREIEAAGALPHLSKTGHSNMMQKVAQIEGALFGGEYSGHYYFKKDGLI
LNDAVYSGFRFLRFIEEVGPEAFEHLPHDLMVPEIRIPYPRELVKGLLLHVKDSAQKNLN
PISFTEIDGLRIEIEGGFLLMRPSNTEQKLTIVIEATSEEELCKLLDFTIAVLEDHEERL
KDRAIDLKDLEPTKSKFGPH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgttaatcacgacgatcccactaaatgtattcaaggaatatgatattcgtggacactat
cctgacgaaatcaacccccaatttgcgtatttgcttgggtttgctcttatggaggtattg
ccaccccaaaacataggtagcgtattaattgcccatgatgcacgtgaggggggaccagag
ctagccaaagccctatataacgcacttaaaacccgggttaaaagtgagcacatacagttt
gctgggttggaacatcctgggcttttagctattcataatatccataaaaattacgggctt
attatttatataacagccagccacaaccctgttgggtttaatggattcaaaatttattgc
gattcgttacccatagattctgagactataaagcttatagcttacaacatgaaacgactc
gcagatgctgacttcaaattcctgcattatagtgaggaaatttttgagcagcctcctatc
gaagaaatcgaaaatagcgagtatataaacgctttgcttagcgagcccgattattgtcag
gaaaagtacatattaaaaattgctattgatggtggcaatggcgttgcgggtctcattgcc
cgtgagttatacgaaaaaatggggcatgaggttttagaacttaactgcataccagacggt
gcgtttccaaatcatcatcccgacccctctgttcccgataatttaatgcagttgcgtaag
tttgtagttgaacatggatgcgatatcgggctggcatttgacggagatgctgatagattg
ggagttgtggactatcaaggtcagattatagggtctgatagggtgtttatttttttaatt
cgagagatgatgaaattttataagtcttactctgattatgaccctgcgaaacccgtgcat
atagtgtatgacataaaatcaagtcggcatatacaaagagagattgaggcggcgggggca
ttgccacatttatctaaaacagggcattcaaatatgatgcagaaagttgcacaaattgag
ggtgctctttttggaggagaatatagtggtcattactacttcaagaaggatggacttatt
ttaaatgatgcggtctattctggatttagatttttaagatttatagaagaagttggacca
gaggcttttgaacatctaccacatgatttaatggtacctgaaattagaattccatatcca
agggagctagtcaaaggactacttttgcatgtaaaagattctgctcaaaagaatctaaac
cccatctcttttactgaaatagacgggttacgtatcgagatagaaggcggatttttgctt
atgcgaccatctaatacggagcagaaattaacaattgttatcgaggcaacttccgaagaa
gagctttgtaaactactggattttacgattgccgtactagaggatcatgaggaacgactt
aaggaccgagccatagatttgaaagaccttgagcccaccaaaagtaaattcggtcctcat
taa

DBGET integrated database retrieval system