KEGG   Taylorella equigenitalis ATCC 35865: KUI_0438Help
Entry
KUI_0438          CDS       T02186                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
tea00010  Glycolysis / Gluconeogenesis
tea00051  Fructose and mannose metabolism
tea00562  Inositol phosphate metabolism
tea01100  Metabolic pathways
tea01110  Biosynthesis of secondary metabolites
tea01120  Microbial metabolism in diverse environments
tea01130  Biosynthesis of antibiotics
tea01200  Carbon metabolism
tea01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KUI_0438 (tpi)
   00051 Fructose and mannose metabolism
    KUI_0438 (tpi)
   00562 Inositol phosphate metabolism
    KUI_0438 (tpi)
Enzymes [BR:tea01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KUI_0438 (tpi)
Exosome [BR:tea04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KUI_0438 (tpi)
  Exosomal proteins of bladder cancer cells
   KUI_0438 (tpi)
  Exosomal proteins of melanoma cells
   KUI_0438 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFN35525
Position
471655..472452
Genome map
AA seq 265 aa AA seqDB search
MGLILDALTIPLIVGNWKMNGSIQANHTLLSALLDGIALWSLPIKQEVVVCPPFPYLHQV
RDILAMDGADSFDPISLGAQDLSFNQNGAHTGDVSAEMLRDFGCDWVIVGHSERKATHSE
STAVVGLKAKMAVDYGITPIVCLGESLELREAGQALHAIDVQLQPILEFGPDLIKSCVFA
YEPVWAIGSGIIANSEQIFEMHSHIRKQIQSVVGQEGNPIRIIYGGSVKPEQAKELFSLD
CVDGALVGGASLNPDEFLSIIEASS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgggtttaatcttggatgcattaaccatacctcttatagttggaaattggaagatgaat
ggcagtatacaagccaatcatacccttttgtcagcactactagacggtattgctttgtgg
tcactgcctataaagcaagaggtggttgtttgccctccattcccttatcttcatcaagtt
cgcgatattttagcgatggatggtgctgattcatttgatccgatttctttaggggctcag
gatttaagttttaatcaaaatggcgctcacacgggtgatgtttcggctgagatgcttaga
gattttggatgtgattgggttattgtaggtcactccgagcgtaaggctactcattctgaa
agtactgctgttgtaggcctaaaggctaagatggcagttgattatggtattacgcctatc
gtctgtttgggtgagagccttgagcttcgagaagctgggcaggctttgcatgctattgat
gttcaacttcagcctatacttgaatttggacctgatcttattaagtcttgtgtctttgct
tacgagccagtttgggctattggctcaggaatcattgcgaatagtgagcaaatttttgag
atgcactcacatattcgaaagcaaattcagtcggtagtaggtcaagagggtaatccaata
cgcattatttatggaggcagtgttaagcccgaacaggctaaagaattatttagtttagat
tgtgttgacggtgcccttgtaggtggtgcttctttgaacccagacgagttcttgagcatt
attgaggcatcttcttaa

DBGET integrated database retrieval system