KEGG   Taylorella equigenitalis ATCC 35865: KUI_0438Help
Entry
KUI_0438          CDS       T02186                                 

Gene name
tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:tea01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tea01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tea00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tea00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tea00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471655..472452
Genome map
AA seq 265 aa AA seqDB search
MGLILDALTIPLIVGNWKMNGSIQANHTLLSALLDGIALWSLPIKQEVVVCPPFPYLHQV
RDILAMDGADSFDPISLGAQDLSFNQNGAHTGDVSAEMLRDFGCDWVIVGHSERKATHSE
STAVVGLKAKMAVDYGITPIVCLGESLELREAGQALHAIDVQLQPILEFGPDLIKSCVFA
YEPVWAIGSGIIANSEQIFEMHSHIRKQIQSVVGQEGNPIRIIYGGSVKPEQAKELFSLD
CVDGALVGGASLNPDEFLSIIEASS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgggtttaatcttggatgcattaaccatacctcttatagttggaaattggaagatgaat
ggcagtatacaagccaatcatacccttttgtcagcactactagacggtattgctttgtgg
tcactgcctataaagcaagaggtggttgtttgccctccattcccttatcttcatcaagtt
cgcgatattttagcgatggatggtgctgattcatttgatccgatttctttaggggctcag
gatttaagttttaatcaaaatggcgctcacacgggtgatgtttcggctgagatgcttaga
gattttggatgtgattgggttattgtaggtcactccgagcgtaaggctactcattctgaa
agtactgctgttgtaggcctaaaggctaagatggcagttgattatggtattacgcctatc
gtctgtttgggtgagagccttgagcttcgagaagctgggcaggctttgcatgctattgat
gttcaacttcagcctatacttgaatttggacctgatcttattaagtcttgtgtctttgct
tacgagccagtttgggctattggctcaggaatcattgcgaatagtgagcaaatttttgag
atgcactcacatattcgaaagcaaattcagtcggtagtaggtcaagagggtaatccaata
cgcattatttatggaggcagtgttaagcccgaacaggctaaagaattatttagtttagat
tgtgttgacggtgcccttgtaggtggtgcttctttgaacccagacgagttcttgagcatt
attgaggcatcttcttaa

DBGET integrated database retrieval system