KEGG   Taylorella equigenitalis ATCC 35865: KUI_0438Help
Entry
KUI_0438          CDS       T02186                                 

Gene name
tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KUI_0438 (tpi)
   01230 Biosynthesis of amino acids
    KUI_0438 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KUI_0438 (tpi)
   00051 Fructose and mannose metabolism
    KUI_0438 (tpi)
   00562 Inositol phosphate metabolism
    KUI_0438 (tpi)
Enzymes [BR:tea01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KUI_0438 (tpi)
Exosome [BR:tea04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KUI_0438 (tpi)
  Exosomal proteins of bladder cancer cells
   KUI_0438 (tpi)
  Exosomal proteins of melanoma cells
   KUI_0438 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471655..472452
Genome map
AA seq 265 aa AA seqDB search
MGLILDALTIPLIVGNWKMNGSIQANHTLLSALLDGIALWSLPIKQEVVVCPPFPYLHQV
RDILAMDGADSFDPISLGAQDLSFNQNGAHTGDVSAEMLRDFGCDWVIVGHSERKATHSE
STAVVGLKAKMAVDYGITPIVCLGESLELREAGQALHAIDVQLQPILEFGPDLIKSCVFA
YEPVWAIGSGIIANSEQIFEMHSHIRKQIQSVVGQEGNPIRIIYGGSVKPEQAKELFSLD
CVDGALVGGASLNPDEFLSIIEASS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgggtttaatcttggatgcattaaccatacctcttatagttggaaattggaagatgaat
ggcagtatacaagccaatcatacccttttgtcagcactactagacggtattgctttgtgg
tcactgcctataaagcaagaggtggttgtttgccctccattcccttatcttcatcaagtt
cgcgatattttagcgatggatggtgctgattcatttgatccgatttctttaggggctcag
gatttaagttttaatcaaaatggcgctcacacgggtgatgtttcggctgagatgcttaga
gattttggatgtgattgggttattgtaggtcactccgagcgtaaggctactcattctgaa
agtactgctgttgtaggcctaaaggctaagatggcagttgattatggtattacgcctatc
gtctgtttgggtgagagccttgagcttcgagaagctgggcaggctttgcatgctattgat
gttcaacttcagcctatacttgaatttggacctgatcttattaagtcttgtgtctttgct
tacgagccagtttgggctattggctcaggaatcattgcgaatagtgagcaaatttttgag
atgcactcacatattcgaaagcaaattcagtcggtagtaggtcaagagggtaatccaata
cgcattatttatggaggcagtgttaagcccgaacaggctaaagaattatttagtttagat
tgtgttgacggtgcccttgtaggtggtgcttctttgaacccagacgagttcttgagcatt
attgaggcatcttcttaa

DBGET integrated database retrieval system