KEGG   Taylorella equigenitalis ATCC 35865: KUI_0510Help
Entry
KUI_0510          CDS       T02186                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tea00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tea00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:tea03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:tea03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tea03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(547853..548302)
Genome map
AA seq 149 aa AA seqDB search
MSEVYEAHGARSIDDIITMSVNSVSAHYSKGRSILVYCHDPKLANKFSERLWSKDDCNFI
PHYFAGDDIVIPPRIIICNEDINDWFKKLNPQPYFLLNLSTDYLKEATLFENILEFVMSE
SESKRLARDRVLKYKQDGHEIKYFEFKYN
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgaagtatacgaagctcacggagccagaagcatagatgacataatcactatgtca
gtaaactccgtgagtgctcattattcaaagggtcgtagcatactggtgtattgccacgat
ccaaaactagcaaataaatttagtgaaagattgtggtctaaggatgattgcaatttcatt
cctcattattttgcgggggatgatattgtaattccccctagaatcattatatgtaatgaa
gatattaatgactggtttaaaaagttaaaccctcaaccttattttttgcttaatttgagt
acggattatttgaaagaagcgactttattcgaaaatattcttgagtttgttatgagtgag
agcgagtcaaaaagattagctcgagatagagtacttaaatacaaacaagacgggcatgaa
attaaatattttgagtttaaatataattaa

DBGET integrated database retrieval system