KEGG   Taylorella equigenitalis ATCC 35865: KUI_0580Help
Entry
KUI_0580          CDS       T02186                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KUI_0580
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KUI_0580
   00620 Pyruvate metabolism
    KUI_0580
   00640 Propanoate metabolism
    KUI_0580
  Energy metabolism
   00680 Methane metabolism
    KUI_0580
Enzymes [BR:tea01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     KUI_0580
Lipid biosynthesis proteins [BR:tea01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   KUI_0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(614425..615846)
Genome map
AA seq 473 aa AA seqDB search
MAIGGLMEEIKTTNMHSSLYDDYEWYIPSNFNIASACCHRWAASPHEARLAAIYFEDQVG
QLTSLSYGQLSEKVNKLANGFVRMGIHPQDRIAIALQHSAETAITILAAITVGAIAVPLG
ISDDSQYYSKRLLDCGARIAIVDKHSFSPFLHAVDHNSQLKNSLKQIIGLNTEDERLIPW
KSLLARQPKDFNVIPVRPDTTAILLYSGVGLDSPNTKSKKGSNSNPQIEKEIVATVISHE
TLIGSLPGFTCSQDWFPQNKDIFFTTYDWSSYYGLMGGLLPTLYFGRTIVGCPSGRTVPR
LLSLIEHYPVTNFFASPDELERIRAYSGVLSSCKYGLRCVSTLAEGCSSALEFWLRESSN
FSFNKILMPVGFSIVISESNGKWPSEAGSAGKAVPGYVLGVFDHEGNKVKTNSFGTLHVK
ETDIHNDSCPGVSTLKWHTNFLHPVPLVDDQWFDTGIAIKIDKNGYYWLKDTM
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
gtggccataggcggtttaatggaagaaattaaaactactaatatgcactctagtctttat
gatgattacgagtggtatataccttcaaattttaatattgcatctgcctgctgtcataga
tgggccgctagtcctcatgaagcaagattagcagctatttattttgaggatcaggtcgga
cagcttacgagcttgtcatatggtcaactttctgaaaaagttaataaattggctaacggt
tttgtacgcatgggtatacatcctcaggaccgtatcgctatcgcacttcagcattcggct
gaaactgctataaccattttagctgccattactgttggggctatagctgtgcctttaggt
attagtgatgactcacagtactattctaagagattgttagactgtggggctagaattgcg
atagtggataagcattcattttctccttttttgcatgctgtcgaccataactcgcaactt
aaaaactctcttaagcaaatcatagggttaaatactgaggatgagcgattaatcccttgg
aagtcattgttagctagacagcctaaggattttaatgttattcctgttagaccagacacg
actgctatacttctttattcaggagtgggacttgatagcccaaatacaaaatcaaaaaaa
ggttctaactcaaatccacagatcgaaaaagaaattgttgccaccgtaatttcacatgag
actttaattggtagtttgcctggatttacatgctcacaggattggtttccgcaaaataag
gacatattttttactacttacgattggagtagttattatgggcttatgggtggattactg
cctactttgtattttggcagaacaattgtgggctgtccgagcggtcgtacagtaccacga
ttattatctttgatagaacattatccagtaactaatttcttcgcctctccagacgaacta
gagcgtattagagcatattcaggtgttctttctagctgtaagtacggtttaaggtgtgtc
tctacccttgctgaaggttgcagttcggcattggaattttggcttagagaatcttcaaat
tttagttttaataaaatccttatgcctgtgggattctcaattgtgatttctgaatctaac
ggaaagtggccttcggaggctggtagtgctggtaaggctgtaccaggttatgtattgggt
gtatttgaccatgagggtaataaggtaaaaaccaattcatttggtacattgcacgttaaa
gaaactgacatacacaatgactcttgtccaggtgttagtaccttgaagtggcatacaaat
tttctacatccagtaccattagtggatgaccagtggtttgacacaggcattgccataaaa
atagataaaaatggatactactggcttaaagacacgatgtga

DBGET integrated database retrieval system