KEGG   Taylorella equigenitalis ATCC 35865: KUI_0580Help
Entry
KUI_0580          CDS       T02186                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
tea00010  Glycolysis / Gluconeogenesis
tea00620  Pyruvate metabolism
tea00640  Propanoate metabolism
tea00680  Methane metabolism
tea01100  Metabolic pathways
tea01110  Biosynthesis of secondary metabolites
tea01120  Microbial metabolism in diverse environments
tea01130  Biosynthesis of antibiotics
tea01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KUI_0580
   00620 Pyruvate metabolism
    KUI_0580
   00640 Propanoate metabolism
    KUI_0580
  Energy metabolism
   00680 Methane metabolism
    KUI_0580
Enzymes [BR:tea01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     KUI_0580
Lipid biosynthesis proteins [BR:tea01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   KUI_0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AFN35665
Position
complement(614425..615846)
Genome map
AA seq 473 aa AA seqDB search
MAIGGLMEEIKTTNMHSSLYDDYEWYIPSNFNIASACCHRWAASPHEARLAAIYFEDQVG
QLTSLSYGQLSEKVNKLANGFVRMGIHPQDRIAIALQHSAETAITILAAITVGAIAVPLG
ISDDSQYYSKRLLDCGARIAIVDKHSFSPFLHAVDHNSQLKNSLKQIIGLNTEDERLIPW
KSLLARQPKDFNVIPVRPDTTAILLYSGVGLDSPNTKSKKGSNSNPQIEKEIVATVISHE
TLIGSLPGFTCSQDWFPQNKDIFFTTYDWSSYYGLMGGLLPTLYFGRTIVGCPSGRTVPR
LLSLIEHYPVTNFFASPDELERIRAYSGVLSSCKYGLRCVSTLAEGCSSALEFWLRESSN
FSFNKILMPVGFSIVISESNGKWPSEAGSAGKAVPGYVLGVFDHEGNKVKTNSFGTLHVK
ETDIHNDSCPGVSTLKWHTNFLHPVPLVDDQWFDTGIAIKIDKNGYYWLKDTM
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
gtggccataggcggtttaatggaagaaattaaaactactaatatgcactctagtctttat
gatgattacgagtggtatataccttcaaattttaatattgcatctgcctgctgtcataga
tgggccgctagtcctcatgaagcaagattagcagctatttattttgaggatcaggtcgga
cagcttacgagcttgtcatatggtcaactttctgaaaaagttaataaattggctaacggt
tttgtacgcatgggtatacatcctcaggaccgtatcgctatcgcacttcagcattcggct
gaaactgctataaccattttagctgccattactgttggggctatagctgtgcctttaggt
attagtgatgactcacagtactattctaagagattgttagactgtggggctagaattgcg
atagtggataagcattcattttctccttttttgcatgctgtcgaccataactcgcaactt
aaaaactctcttaagcaaatcatagggttaaatactgaggatgagcgattaatcccttgg
aagtcattgttagctagacagcctaaggattttaatgttattcctgttagaccagacacg
actgctatacttctttattcaggagtgggacttgatagcccaaatacaaaatcaaaaaaa
ggttctaactcaaatccacagatcgaaaaagaaattgttgccaccgtaatttcacatgag
actttaattggtagtttgcctggatttacatgctcacaggattggtttccgcaaaataag
gacatattttttactacttacgattggagtagttattatgggcttatgggtggattactg
cctactttgtattttggcagaacaattgtgggctgtccgagcggtcgtacagtaccacga
ttattatctttgatagaacattatccagtaactaatttcttcgcctctccagacgaacta
gagcgtattagagcatattcaggtgttctttctagctgtaagtacggtttaaggtgtgtc
tctacccttgctgaaggttgcagttcggcattggaattttggcttagagaatcttcaaat
tttagttttaataaaatccttatgcctgtgggattctcaattgtgatttctgaatctaac
ggaaagtggccttcggaggctggtagtgctggtaaggctgtaccaggttatgtattgggt
gtatttgaccatgagggtaataaggtaaaaaccaattcatttggtacattgcacgttaaa
gaaactgacatacacaatgactcttgtccaggtgttagtaccttgaagtggcatacaaat
tttctacatccagtaccattagtggatgaccagtggtttgacacaggcattgccataaaa
atagataaaaatggatactactggcttaaagacacgatgtga

DBGET integrated database retrieval system