KEGG   Taylorella equigenitalis ATCC 35865: KUI_0704Help
Entry
KUI_0704          CDS       T02186                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
tea00020  Citrate cycle (TCA cycle)
tea00310  Lysine degradation
tea01100  Metabolic pathways
tea01110  Biosynthesis of secondary metabolites
tea01120  Microbial metabolism in diverse environments
tea01130  Biosynthesis of antibiotics
tea01200  Carbon metabolism
Module
tea_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tea_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KUI_0704
  Amino acid metabolism
   00310 Lysine degradation
    KUI_0704
Enzymes [BR:tea01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KUI_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 Arabino_trans_C SOBP
Motif
Other DBs
NCBI-ProteinID: AFN35784
Position
758961..760205
Genome map
AA seq 414 aa AA seqDB search
MSIVNVVVPQLSESVSEGTLIEWKFKVGDQVSVDEILVEIETDKVLLEVPSPSAGVITEI
LEQDGATVTPDQVLAKIDTEAKAEAKAEDTSKQSEPKEVAQSSKETTVESAKSDNSLAQK
SGSKGDVASPAARNILAEKDMKASDVAGSGRDGRVTKADAQKASKGSSVSKPSAPMATNT
EGRIEERIPMTRLRARVAERLIQSQQQNAILTTFNEVNMKPVMDLRNKYKESFEKEHGIK
LGFMSFFVKAAVHGLKKYPILNASVDGNDIVYHGYFDIGVAVSSPRGLVVPVIRNADQLS
FADIEKTIAEFGQKAKEGKLGLDELTGGTFTVSNGGVFGSMMSTPIINPPQSAILGIHAT
RERAVVENGEIVIRPMNYFALSYDHRIIDGREAVLGLVAMKEALEDPQRLLLNL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattgttaatgttgtagtacctcagctttctgagtcagtgtcagagggcactctt
attgaatggaaatttaaagtaggtgatcaagtttctgttgatgaaattttggttgagatt
gaaactgataaagttcttcttgaagttccatctccatctgcaggtgtaattactgagatt
ttagagcaagacggtgcaaccgtaactcctgatcaagttttagcgaaaattgatactgaa
gctaaagctgaggctaaagctgaggatacatcaaaacaatcagaacctaaggaagttgct
caatcttctaaagaaactactgtagaatctgctaaatcagataattcattagctcaaaaa
tctggttcaaaaggtgatgtagcttctccagctgctcgtaatattcttgctgaaaaagat
atgaaagcctctgatgttgccggttcaggtcgcgatggtcgcgtaactaaagctgatgct
caaaaagcatctaaaggctcttctgtttctaaaccatctgcacctatggctactaacact
gaaggtcgtatcgaagaacgtattcctatgactcgtttacgtgctcgtgtcgcagaaaga
ttaattcaatcacaacaacaaaacgcaatacttactacatttaacgaagtgaacatgaaa
cctgttatggaccttcgtaataagtacaaggagtcattcgaaaaagaacatggaattaaa
ttaggctttatgtctttctttgtgaaagctgctgttcatggacttaaaaaatatccaatt
cttaatgcttctgttgatggcaatgatatcgtttaccacggttattttgatattggtgtt
gcggtttcaagcccacgtggtctagtagttcctgtaatccgtaatgctgatcaactaagc
tttgctgatattgaaaaaacaattgctgaatttggtcaaaaagctaaagagggtaaatta
ggtttggacgaattaacaggtggtactttcacagtttctaacggtggtgtattcggttct
atgatgtctaccccaatcatcaatcctccacaatcagcaatactaggtatccatgcaact
cgcgaacgtgcagtagttgaaaacggtgaaatcgttattcgtcctatgaactactttgca
ctttcttatgatcatagaattatcgacggacgtgaggctgtacttggattagttgctatg
aaagaagcacttgaagatccacaacgtcttcttttaaatctgtaa

DBGET integrated database retrieval system