KEGG   Taylorella equigenitalis ATCC 35865: KUI_0717Help
Entry
KUI_0717          CDS       T02186                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
tea00260  Glycine, serine and threonine metabolism
tea00750  Vitamin B6 metabolism
tea01100  Metabolic pathways
tea01110  Biosynthesis of secondary metabolites
tea01120  Microbial metabolism in diverse environments
tea01230  Biosynthesis of amino acids
Module
tea_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KUI_0717 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KUI_0717 (thrC)
Enzymes [BR:tea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KUI_0717 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AFN35797
Position
774009..775499
Genome map
AA seq 496 aa AA seqDB search
MKYVSTRGGVEPAEFCDILIEGLAADGGLYVPESIPYIDIEVLEGWRNLTYKQVALQVLS
LLITDIPYNDLKNIIDKTYTLDNFESSEIVPLKKFKFGHAKEFYLLGLSEGPTLAFKDLP
LQFLGNLYEYVLNKNQTYVNVLGSTSGDTGSAAEYALKGKKGVNVFMLSPHGRMSDFQKA
QMYTLDNPNIHNLAVKGVFDECQDIVKAINGDLEFKRKHHIAAVNSINFARIAAQVVYYF
WAWLQVSKPVESKYRDSKINDNLKHKNIATYKAEVIDVTVPTGNFGNILAALIASMMGCP
LGDLIVATNENNVLEEFFKTGVYKPRIPAETIATSSPSMDISKASNFERFVYFLYDCDAS
KVKDLWSRLAEDGSFDLSERLSEIEGTDHFFTFKAGRSTHEDRIKTIKDFYDKTEYILDP
HTADGVKVSSEFQSENKIMVVAETALSTKFAITVKESLGFEPKVPERFNEMLNKPRHEVV
TENSVEEVKDYIQKHS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgtatcaaccagaggtggagtcgaaccagctgaattttgcgatattttaatt
gaaggtttggctgcagatggtggattatatgtgccagagtctattccatatatagatata
gaagtgcttgaaggttggagaaatcttacatataagcaagtagctctacaggttttaagt
ttattaataactgatattccatataacgaccttaaaaacattatcgataaaacatacaca
ttagataattttgaaagtagtgaaatagttcctcttaaaaaatttaaattcggacatgca
aaagaattttatctattaggattgtcagaggggccgactttagctttcaaggatcttcct
ttgcagtttttgggaaacctttatgaatatgtcctaaataagaaccaaacatatgtaaat
gttttgggatctacatcaggagatactgggtctgcagctgaatatgcattaaaaggaaaa
aaaggcgtaaatgtctttatgctctcaccgcatggtcgtatgagtgattttcagaaagcc
cagatgtacactttagataatccaaacattcacaatttagcagtcaaaggtgtatttgat
gaatgtcaggatatagtaaaggctattaatggcgatttagagtttaagagaaagcatcat
atagcggcagtgaattcaattaattttgcacgcattgcagcacaagttgtgtactacttt
tgggcttggttacaggttagtaagccagttgagtcaaaatatagagatagcaaaattaat
gataatttgaagcacaaaaacattgccacttacaaagctgaagttatagacgtaaccgta
cctacaggtaattttggcaatattctggcagccttaattgcatctatgatgggatgtcct
ttgggtgatttgattgtagctacaaatgaaaataacgtacttgaagaattttttaaaact
ggcgtctataaaccacgtattcctgctgaaaccattgccacatcaagtccatctatggat
atttctaaggcctcaaattttgagcgtttcgtatatttcttatatgattgtgatgcctct
aaggttaaagatctttggagccgtttagctgaagatggaagttttgatctttctgagaga
ctaagtgaaattgagggaactgatcacttctttacttttaaagcgggtcgtagtactcat
gaagatcgaattaaaacaatcaaagatttctacgataaaaccgaatatatcctagatcca
catactgctgacggtgtaaaagtttcatctgaatttcaatcagaaaataagattatggta
gtcgcagaaacagctctatctactaagtttgctattacagttaaagaatctttaggattt
gagcctaaagttcctgagcgatttaatgaaatgctcaataaacctcgtcatgaagtagtt
acggaaaactcagtggaagaggtgaaggactatatccaaaagcattcataa

DBGET integrated database retrieval system