KEGG   Taylorella equigenitalis ATCC 35865: KUI_0733Help
Entry
KUI_0733          CDS       T02186                                 

Definition
(GenBank) hypothetical protein
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
tea00790  Folate biosynthesis
tea01100  Metabolic pathways
Module
tea_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KUI_0733
Enzymes [BR:tea01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     KUI_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: AFN35813
Position
796622..797302
Genome map
AA seq 226 aa AA seqDB search
MSEESKYISAVIKKRIQAAGQRFHANDNISEFILDGELDLLQKEVESKLKEVLESLVIDI
DSDHNTLETAKRVSKMYIREIFSGRYEPIPDVTEFPNIESVNELIVVGPITIRSACSHHL
CPIMGHCYIGVMPHKESNLIGLSKYARIAHWIMQRPQIQEEAIMQLANILEQKLKPKGIA
VIMKADHYCMKWRGVKDNDSKMINSVMRGCFLTDSDLRREFLALIS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaaagcaaatacatttctgcagtaataaaaaagcgtatacaggctgcagga
cagcgttttcacgccaatgacaatatttcagaatttattcttgatggagaattggatttg
cttcagaaagaagttgagtcaaagttgaaagaggttcttgaaagccttgttatagatata
gattctgaccacaatacgcttgagacggccaaacgtgtttctaagatgtatattcgagag
atattttcaggacgctatgagcctattcctgatgttactgagtttccaaatatagaaagc
gtaaatgaacttattgtcgtaggtccaattactattaggagtgcgtgttctcatcatttg
tgtccaattatggggcattgttatattggagttatgccacataaggaatctaatttaatt
gggctttctaagtatgcgcgcattgcacattggattatgcaacgaccgcaaattcaggaa
gaggctattatgcaattggcaaatattcttgagcagaaattaaaaccaaagggtattgca
gttattatgaaagccgatcactactgcatgaagtggcgcggcgtaaaagacaacgacagc
aagatgataaatagtgttatgcgaggttgttttttgactgattcagatttacgtagagag
tttctagctttgatttcttag

DBGET integrated database retrieval system