KEGG   Taylorella equigenitalis ATCC 35865: KUI_0733Help
Entry
KUI_0733          CDS       T02186                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KUI_0733
Enzymes [BR:tea01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     KUI_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
796622..797302
Genome map
AA seq 226 aa AA seqDB search
MSEESKYISAVIKKRIQAAGQRFHANDNISEFILDGELDLLQKEVESKLKEVLESLVIDI
DSDHNTLETAKRVSKMYIREIFSGRYEPIPDVTEFPNIESVNELIVVGPITIRSACSHHL
CPIMGHCYIGVMPHKESNLIGLSKYARIAHWIMQRPQIQEEAIMQLANILEQKLKPKGIA
VIMKADHYCMKWRGVKDNDSKMINSVMRGCFLTDSDLRREFLALIS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaaagcaaatacatttctgcagtaataaaaaagcgtatacaggctgcagga
cagcgttttcacgccaatgacaatatttcagaatttattcttgatggagaattggatttg
cttcagaaagaagttgagtcaaagttgaaagaggttcttgaaagccttgttatagatata
gattctgaccacaatacgcttgagacggccaaacgtgtttctaagatgtatattcgagag
atattttcaggacgctatgagcctattcctgatgttactgagtttccaaatatagaaagc
gtaaatgaacttattgtcgtaggtccaattactattaggagtgcgtgttctcatcatttg
tgtccaattatggggcattgttatattggagttatgccacataaggaatctaatttaatt
gggctttctaagtatgcgcgcattgcacattggattatgcaacgaccgcaaattcaggaa
gaggctattatgcaattggcaaatattcttgagcagaaattaaaaccaaagggtattgca
gttattatgaaagccgatcactactgcatgaagtggcgcggcgtaaaagacaacgacagc
aagatgataaatagtgttatgcgaggttgttttttgactgattcagatttacgtagagag
tttctagctttgatttcttag

DBGET integrated database retrieval system