KEGG   Taylorella equigenitalis ATCC 35865: KUI_0782Help
Entry
KUI_0782          CDS       T02186                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (e2) protein (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:tea01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tea00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tea00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tea00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
848058..849503
Genome map
AA seq 481 aa AA seqDB search
MSQLIEVKVPDIGDFDDVSVIEVLVKEGDKISVDQSIITVESDKASMEIPSSASGIIKKL
SVKLGDKVKEGVVLLTVESTDGDSKGQSSEISQIDDSKAADNSVNEKNVSKEQGAGGDSG
IYDIKASQLTQEKQNTVEDNASSMTFVAQSSDAGDKVGKSKESPTAAYALTANEIRNLPH
ASPSVRQFARSLGVDLNQVKGTGRKNRIVLDDVRSFVKSALSAPGGVTTGSSTLGGSGLS
VLDWPKVDFSKFGEIDSKPLSRIKKISGANLHRNWVMIPHVTNNDEADITDLEAFRVQLN
KEHEKAGIKFTMLAFIFKAVVQALKKYPEFNSSIDGENIVYKKYFHLGFAADTPNGLVVP
VIRDADKKSISDIAKETSELAKLARDGKLSPSQMQGGCFTISSLGGIGGTHFTPIINAPE
VAILGVSRSYQKPVWNGKEFQPRLTLPLSLSYDHRIIDGAAAARFNVCLCQILSDFRRAM
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaattaattgaagtaaaagttcctgatataggcgattttgatgatgtatctgtt
attgaagtgcttgttaaagagggggataaaatttctgtagaccaaagtattattactgtt
gagtccgataaagcctctatggagattccaagtagtgcttctggaatcattaaaaaacta
tcagttaaattgggagacaaagttaaagaaggagtggtgctgttaactgttgaatcaact
gatggcgactctaagggtcaatcttctgaaatttcacaaattgatgattctaaagcggct
gataattctgttaatgagaaaaatgtttccaaagagcagggagctggaggggattcagga
atttatgatattaaagcatctcaattaacacaagaaaaacaaaatacagttgaagataat
gcgtcttctatgacatttgttgctcaatcttctgatgctggagataaggttggcaaaagt
aaagaatcacctactgctgcttatgctttaactgcaaacgaaatacgtaatcttccacat
gcatctccatctgtaaggcaatttgctcgttccttaggtgtagatttaaatcaagtaaaa
ggcacaggtcgtaaaaatagaattgtgcttgatgatgttaggtctttcgtaaaatccgca
ctatcagcacctggcggagttacaactggatcttctactttaggcggttcaggattatca
gttcttgattggcctaaagttgatttttctaaatttggtgagatcgacagtaaaccgctt
tctcgtattaagaaaatttcgggagcaaaccttcatagaaattgggtaatgattccacac
gtaaccaataacgatgaagctgatattactgatttagaagctttcagagttcaacttaat
aaagaacatgagaaagctggtattaaatttacaatgcttgcttttatctttaaggctgtt
gttcaagctttgaaaaaatacccagagtttaattcatctattgatggtgaaaatattgtg
tataaaaaatattttcatcttgggtttgctgcagatacacctaatggattagtagtgcct
gtaataagagatgctgataaaaaatccatttcggatatagccaaagaaacctcagaactt
gctaaattagcacgtgatggaaaattgagcccatctcaaatgcaaggtggatgcttcaca
atatcatctttaggaggtattgggggtactcatttcacacctattattaatgcacctgaa
gtggctatattgggcgttagtcgctcataccagaaaccagtttggaatggcaaagaattc
cagcctcgtcttacattgccactatccttgtcatatgatcacaggattattgatggtgca
gctgcagctaggtttaatgtatgtctatgtcaaattttgtctgatttcagaagggctatg
atttaa

DBGET integrated database retrieval system