KEGG   Taylorella equigenitalis ATCC 35865: KUI_0868Help
Entry
KUI_0868          CDS       T02186                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
tea00300  Lysine biosynthesis
tea01100  Metabolic pathways
tea01120  Microbial metabolism in diverse environments
tea01230  Biosynthesis of amino acids
Module
tea_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    KUI_0868 (dapE)
Enzymes [BR:tea01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     KUI_0868 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42 Fer4_14 Fer4_12 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AFN35941
Position
940874..942019
Genome map
AA seq 381 aa AA seqDB search
MNTQNITTLELLKDLISRESISPNDAGCQDVLADLLKKQGFKAEFMEFGAVKNLWIRHGD
LAPLVVFAGHTDVVPSGPRDLWDSPPFEPTIRNNKLYGRGAADMKAGVAASAIASYEFVK
AYPNHNGSVALLITSDEESIAIDGTVKVCEVLEKRGESIDYCVVAEPSCVDKLGDTIKIG
RRGSYGATLTIKGKQGHVAYPHKVKNPIHLAAPAVAELCSTVWDEGNKFFPPTSFQISNY
RAGTGAANVVPGIAHIEFNFRFCTESTPESLKNRVEEILNKHNLDYEIEWILGGEPFLTE
AEDLTKAMIDSIKEVTGVDAQLSTTGGTSDGRFIAKMNPKPKVLEFGVINASIHQINEHV
DVDDLEKSKDIYFKVLEKLLA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaacactcaaaatataaccacacttgaactgcttaaagatttaatttcacgtgaatcc
atttcaccaaacgatgctggatgccaggatgtattagcagatcttcttaaaaaacaaggt
tttaaagcggaattcatggagtttggtgctgtaaaaaacctttggattcgtcatggagac
ctagcaccattagtagtatttgctggacacactgatgttgtaccctctggacctagggat
ttgtgggattctccacctttcgaacctactattcgaaacaataaactttatggacgtggg
gctgctgatatgaaagcaggagttgctgcaagtgccattgccagctatgaatttgttaaa
gcatatccaaatcataatggttcagttgctcttttgattacctctgatgaggaaagtatc
gctatcgatggcacggtaaaagtctgtgaagtccttgaaaaacgcggtgaatctattgac
tactgtgtcgtagccgaaccttcatgtgtagataaattgggagatactattaaaattggt
cgtcgtgggtcttacggggctactttgactattaaaggtaaacaaggacatgtagcttat
ccacataaagtcaaaaatcctattcatttagcggcacctgctgttgctgaattatgtagt
actgtttgggatgagggtaataaattctttccccctacttcatttcagatatccaattat
cgtgctggtactggtgcagcaaatgtagtccctggaattgctcacattgaatttaatttc
agattctgcactgaaagcactcctgaatcattaaaaaatcgtgttgaagaaatactaaat
aaacacaacctagactatgaaatcgaatggattctaggaggcgagccttttttaactgaa
gccgaagatttaacaaaagcgatgattgattccatcaaagaagtaactggtgttgatgct
caattgagcactactggtggtacatcagacggcaggtttatcgcaaaaatgaatcctaaa
ccaaaggttttggaatttggtgtaattaatgccagcattcaccaaataaacgagcatgtt
gatgtagatgacttagaaaaaagcaaagacatttactttaaagtattagaaaaactttta
gcttaa

DBGET integrated database retrieval system