KEGG   Taylorella equigenitalis ATCC 35865: KUI_1237Help
Entry
KUI_1237          CDS       T02186                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tea00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KUI_1237 (recR)
DNA repair and recombination proteins [BR:tea03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      KUI_1237 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1340868..1341464)
Genome map
AA seq 198 aa AA seqDB search
MTQEPEPLQALIESISGLPGIGVRTARRLAYHMLQNDREGAEYLAHNIKSALITLKHCSK
CNNFSSSDICDICSSNKRDLTTLCIVETPADLIRIEESHGYRGLYYVLMGRITPMSPKGA
QGLNFEHLIERVKESGIKEVIIATNFTTEGETTAHFIKTLFSDLDIQTSRIARGVPSGSE
LEYVDAATIAWALNDRKK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggaaccagagccactccaagcacttattgaatcaatttctggtttaccaggt
attggtgtaagaactgctagaagacttgcctatcatatgcttcaaaatgatagggaaggt
gccgagtatttggcacataacattaaatctgcattgattacacttaagcattgttcaaaa
tgtaataacttttcaagttctgatatatgtgatatctgctcatctaataagcgagattta
acaactttatgcatcgttgagacgccagcagatttaattagaattgaagaaagtcatggg
tatagggggctttattatgtgttgatgggtagaattacacctatgtccccaaaaggagct
caaggtcttaattttgagcacttaattgaaagagtaaaggaatcaggcattaaagaagta
attattgccacaaactttacaacagaaggtgaaacaactgctcatttcataaaaacactt
ttttcagatttggatattcaaacaagtcggattgctcgaggcgtccctagtggtagtgaa
cttgaatacgtagatgcggctactatcgcatgggctttaaatgatagaaagaaatag

DBGET integrated database retrieval system