KEGG   Taylorella equigenitalis ATCC 35865: KUI_1237Help
Entry
KUI_1237          CDS       T02186                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tea03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1340868..1341464)
Genome map
AA seq 198 aa AA seqDB search
MTQEPEPLQALIESISGLPGIGVRTARRLAYHMLQNDREGAEYLAHNIKSALITLKHCSK
CNNFSSSDICDICSSNKRDLTTLCIVETPADLIRIEESHGYRGLYYVLMGRITPMSPKGA
QGLNFEHLIERVKESGIKEVIIATNFTTEGETTAHFIKTLFSDLDIQTSRIARGVPSGSE
LEYVDAATIAWALNDRKK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggaaccagagccactccaagcacttattgaatcaatttctggtttaccaggt
attggtgtaagaactgctagaagacttgcctatcatatgcttcaaaatgatagggaaggt
gccgagtatttggcacataacattaaatctgcattgattacacttaagcattgttcaaaa
tgtaataacttttcaagttctgatatatgtgatatctgctcatctaataagcgagattta
acaactttatgcatcgttgagacgccagcagatttaattagaattgaagaaagtcatggg
tatagggggctttattatgtgttgatgggtagaattacacctatgtccccaaaaggagct
caaggtcttaattttgagcacttaattgaaagagtaaaggaatcaggcattaaagaagta
attattgccacaaactttacaacagaaggtgaaacaactgctcatttcataaaaacactt
ttttcagatttggatattcaaacaagtcggattgctcgaggcgtccctagtggtagtgaa
cttgaatacgtagatgcggctactatcgcatgggctttaaatgatagaaagaaatag

DBGET integrated database retrieval system