KEGG   Taylorella equigenitalis ATCC 35865: KUI_1258Help
Entry
KUI_1258          CDS       T02186                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tea00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1365618..1366109
Genome map
AA seq 163 aa AA seqDB search
MPKAFIGLGSNLGDEIKFLQKAVQRLISHDSITLLKTSSVYKTSPVDSEGDDYLNAVISI
DTELSPNELLKLMQTIEFDLGRERPYKNAPRTIDLDLLLYEEFVLETQFLTLPHPRMAMR
AFVLVPLREISPSEKINGVAIDFYISQLPPNQKIHKTNYSLKP
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaaagcatttattggtttaggctctaatttgggagatgaaattaagtttttacaa
aaagccgttcaaagacttatttctcatgactccataactctattaaagacttcaagcgta
tataaaacaagtccagtagatagcgaaggtgacgattacttaaatgcagttatttctatt
gatactgaattaagccctaacgaattgctcaaattaatgcaaacaatcgaatttgattta
ggaagagagagaccatataaaaacgctcctcgaacgatagatttagatttgcttttatat
gaagagtttgtgcttgaaactcaatttttaactctacctcatcctcgtatggccatgaga
gcttttgtgcttgtaccgttgcgagagatttcaccctcagaaaaaattaacggggttgca
attgatttttatatctcacaacttcccccaaaccaaaaaatacataaaactaattacagt
ttaaagccataa

DBGET integrated database retrieval system