KEGG   Taylorella equigenitalis ATCC 35865: KUI_1259Help
Entry
KUI_1259          CDS       T02186                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KUI_1259 (gtaB)
   00052 Galactose metabolism
    KUI_1259 (gtaB)
   00500 Starch and sucrose metabolism
    KUI_1259 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    KUI_1259 (gtaB)
Enzymes [BR:tea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KUI_1259 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1366091..1366951)
Genome map
AA seq 286 aa AA seqDB search
MSTSSKKVTKAVFPVFGFGTRFLPITKSLPKEMLPIIDKPLLHYAVKEAVDAGIRDLIFI
VGSNRQSIEDYFDRNLPLENKLESDGKLEELGQVRDIVPPNVNCIFIRQHSPIGLGHAVL
KAKPVIGEDSFAVVLVDDLFYSQPHEESALQTLINHYEQFECSVIGTHEVNPESIHNYGV
ISGTQNDDEEATVLDGIVEKPIAERAPSNQAVLGRYVLDSKIFSCIEQTVVGKNGEIQLT
DAIEKLIQSEKVHAIPIKIRHFDCGSKEGWYKANMFFGDKIYGFKL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcacatcgagtaagaaagtaactaaagctgtatttccagtttttggatttggaact
agatttttgccgataacgaaatcattgccaaaggaaatgctaccaattatcgataaacca
ctacttcattatgcggtgaaagaggctgtggatgcgggtattagggatttaatatttatc
gtaggcagtaacagacaaagtatagaagattattttgatagaaatttgcctctagaaaat
aaacttgaatcagatggaaagctcgaggaattaggtcaagttcgtgatattgtgcctccg
aatgttaattgcatttttataagacagcattctcccataggtcttgggcatgctgtactt
aaagcgaaacctgtaataggggaggattcgttcgcagtagttttagtagacgatttgttc
tattcgcaaccgcacgaggaatcggctttgcagacactaattaatcattatgagcaattc
gaatgctcagttattggtacacatgaggtaaacccagaatccattcataattatggagtt
atttctgggactcaaaatgatgatgaagaggctacagttttagatggaattgtagagaaa
ccaattgctgaacgagctccatcaaatcaagctgtattaggaagatatgtattggattca
aaaattttttcttgtattgagcaaacggtcgttggaaaaaatggagagattcagctcaca
gatgccatagaaaaacttatacagtcagaaaaagtacatgccattcctatcaaaatcagg
cattttgactgtggttctaaagaaggttggtataaggcgaatatgttttttggagataaa
atttatggctttaaactgtaa

DBGET integrated database retrieval system