KEGG   Taylorella equigenitalis ATCC 35865: KUI_1334Help
Entry
KUI_1334          CDS       T02186                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tea  Taylorella equigenitalis ATCC 35865
Brite
Enzymes [BR:tea01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     KUI_1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1447086..1448228)
Genome map
AA seq 380 aa AA seqDB search
MKFASKLLVTCMVAAFASSAIAAERYKPDNELIEPIKAAKVENQAEVDLGAKLYFDPRLS
RSGFISCNSCHNLSMGGTDNLQTSIGDKWQQGPINAPTVLNSTLNFVQFWDGRAKDLKEQ
AGGPIANPGEMAFTHDLAVGLLNSIPQYVEEFKKVYGKEKIDIDQVTKAIATFEDTLVTP
NSRFDQWLSGKEDAITDQELQGYLTFRDAGCVACHNGAAVGGSTFQKMGVVDVYVTDNAS
AGRAGVTGQDIDRMMFKVPTLRNVELTYPYFHDGAANTLKQAVETMGRLQLGKKFTDEEN
ANIVAFLKTLTGDQPDLKLPIIPPSSDATPRPNPWAEMAKAEDKKEDAKPMVAPQGDDRK
ATMPVEKPKMEEKKVEAPKA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcgtctaagcttttagttacctgtatggtcgcagcttttgcttcaagtgca
attgctgccgaaagatacaaaccagataatgaattgattgaaccaattaaagcagctaaa
gttgaaaatcaagcagaagtagatttaggtgcaaaattatatttcgatccacgtctatca
cgttcagggtttatttcctgtaactcttgtcataacctttctatgggcggtactgataac
cttcagacatccatcggcgataagtggcagcaaggacctattaatgctcctacagttctt
aactctactttaaattttgttcagttctgggatggtcgtgcaaaagacttaaaagagcaa
gctggaggtccgattgcaaaccctggggagatggcattcactcacgatttagctgttggt
cttttaaactctattcctcaatatgttgaagagttcaaaaaagtttacggaaaagaaaaa
atagatatcgaccaagttactaaagctatcgctacttttgaagatacattagttactcct
aattctcgctttgaccagtggttatctggtaaagaagatgctatcactgatcaagaactt
caaggatacttgactttcagggatgcaggatgcgtggcttgccataacggggctgcggta
ggcggttctacattccaaaaaatgggtgtagttgacgtatacgtaacagataatgcatct
gctggtcgtgcaggtgttactggtcaagatattgaccgtatgatgtttaaagttcctact
ctacgtaatgttgaattaacttatccgtacttccacgatggtgcagctaacactctaaaa
caagctgtagaaactatgggtcgtttacagttaggtaaaaaattcactgatgaagaaaac
gctaatatagttgctttcttaaaaactttaactggtgaccagcctgaccttaaacttcca
atcattcctccttcaagtgatgctacccctcgtccaaatccatgggcagaaatggcgaaa
gctgaagataaaaaagaggatgctaaacctatggtagctccacagggtgatgatagaaaa
gcaactatgcctgttgaaaagcctaaaatggaagaaaaaaaggtagaagctcctaaagcc
taa

DBGET integrated database retrieval system