KEGG   Taylorella equigenitalis ATCC 35865: KUI_1446Help
Entry
KUI_1446          CDS       T02186                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KUI_1446
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KUI_1446
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KUI_1446
Enzymes [BR:tea01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KUI_1446
Exosome [BR:tea04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KUI_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1569178..1571148)
Genome map
AA seq 656 aa AA seqDB search
MGFKYFFPRGSKDMQKKWIKSVLATSVFAGLCMGAVASAKITDLVPVDQKAFDIIKNRME
NSAEKTGITILPIDQAKFLKGQRFDFEVEVADETTKSVEVTFNGKSFKDIFGADLKRIEN
QTKDGKKYVSFRAENVSIASVGDIELVVNAETDSGKKTRKVMWSVVSDASDKKAKNVILF
VGDGMSLQAKQLARILSKGIYEGRYNNLLAMETLPNVAIVSTSGYDSIVTDSANSASAYN
TGHKSVVNAMGVYENHTEDTLDDPKVETISEIVKRTRGMAVGIVTTASVTDATPAAVTAH
TRRRGDQDYIAADFLAEYHRPDVLLGGGIRYFVPKAQAGSKRKDETDVIKDFEAKGFTYV
GNRKEMNAAPDDKPLLGLFASNHMDVYMDREHIPNKEVTKGFDDQPNLVEMTKKALDIVS
KNPNGFYLMVEGASIDKQIHTMDWQRAVYDAIEMDKAVEYAKNWSKQNGDDTLIVVIADH
AHGISITGTYTEADGRKGRDAVRTYAEAKYPNFVDEDGDGFPEDPNPEHTLAVQYANFPD
HYENYRFQTKPTAPALAAKDADGKETIKANPARAPEGARLIEGNLPTDKETQEVHSADDI
VVMAGGPGSDYFKGHIENVEVFFGIMRALGIDAVAEKAQASESKATEAKPEQKPAQ
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgggatttaaatatttttttcctagaggaagtaaagacatgcaaaaaaaatggatcaaa
tctgtgcttgcaactagtgtatttgctggtttatgcatgggtgcagtagcttctgcaaaa
atcactgaccttgtaccagtagatcaaaaagcttttgatatcatcaaaaaccgtatggaa
aacagtgctgaaaaaacaggcattactatcctacctatcgatcaagcgaaattccttaaa
ggtcaacgttttgacttcgaagttgaagttgctgacgagacaactaaatctgttgaagtt
actttcaacggtaaatcattcaaagatattttcggtgctgatttaaaacgcattgaaaac
caaactaaagacggtaaaaaatatgtttctttccgtgcagaaaacgtatcaatcgctagc
gttggtgatatcgaattagtagttaatgctgagactgattctggcaaaaaaactcgtaaa
gttatgtggtcagttgttagcgatgcttctgataaaaaagctaaaaacgtgatcctattt
gttggtgatggtatgagccttcaagctaaacagcttgctcgcatcctttcaaaaggtatt
tatgaaggacgttataacaaccttttagcaatggaaactcttccaaacgtagcaatcgtt
tctacttctggttatgattctatcgtgactgactctgctaactctgcatcagcttacaac
actggtcataaatcagtagttaatgctatgggtgtttatgaaaaccatacagaagacact
ttggacgatcctaaagttgaaactatttctgaaattgttaaacgtactcgtggtatggcc
gttggtatcgtaactacagcctcagtaactgatgctactccagctgctgtaactgctcac
actcgtcgtcgcggtgaccaagattatatcgctgcagacttcctagctgaatatcaccgt
cctgacgtacttcttggtggcggtatccgttacttcgttcctaaagctcaagctggttct
aaacgtaaagatgaaactgatgtaatcaaagacttcgaagcaaaaggcttcacatacgtt
ggtaaccgtaaagagatgaatgcagctcctgacgataagccacttttaggtctgttcgct
tcaaaccatatggacgtttatatggatcgtgaacacatccctaataaagaagtaactaaa
ggatttgacgatcaacctaacttagttgaaatgactaaaaaagctcttgatatcgtttct
aaaaatccaaacggtttctacctaatggttgaaggtgcatctatcgataaacaaattcac
actatggattggcaacgtgcagtatacgatgcaattgaaatggataaagcagttgaatat
gctaaaaactggtctaaacaaaatggtgacgatactctaatcgttgttattgccgaccat
gctcatggtatttcaatcacaggtacttatactgaagctgacggtagaaaaggtcgtgat
gcagtacgtacttacgctgaggctaaataccctaactttgtagatgaagacggtgacggt
ttcccagaagatccaaatccagaacacactttagcagttcaatatgctaacttccctgat
cactacgagaactatcgattccaaactaaacctactgctccagctctagctgcaaaagat
gctgatggtaaagaaactatcaaagctaatccagctcgtgctccagaaggtgctcgttta
atcgaaggtaatttacctactgataaagaaactcaagaagttcactcagctgacgatatc
gttgttatggctggcggtccaggctctgactacttcaaaggtcacattgaaaatgttgaa
gtattcttcggtattatgcgtgctcttggtatagatgctgttgctgaaaaagctcaagct
tcagaatcaaaagcaactgaagctaaacctgaacaaaaaccagcacaataa

DBGET integrated database retrieval system