KEGG   Taylorella equigenitalis ATCC 35865: KUI_1504Help
Entry
KUI_1504          CDS       T02186                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KUI_1504
Enzymes [BR:tea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     KUI_1504
Exosome [BR:tea04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KUI_1504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1628593..1629606
Genome map
AA seq 337 aa AA seqDB search
MYSLLPPKYPTQRLRRNRRDDFSRRLVQENHLSPSDFIYPVFVQDEQKEPVAVASLPGVF
RHSIESLLPVAEECVKLGIPVIALFPAVDSNLKTPDGIEACNPDGLIPRVVERLKKEFPA
LGIMCDVALDPYTSHGQDGIIDENGYVLNDETIEVLRKQALTQAQAGADYVAPSDMMDGR
IGRVREILDDHDLIYTKIMAYSAKYASSFYGPFRDAVGSTSNLGKSNKFTYQIDPANRLE
AFHEVAADIQEGADLVMVKPGLPYLDILREVKDMFAKPTFAYQVSGEYCMLKAAAANGWI
NHNAVMMESLLCFKRAGADGILTYSAIEAAKLLKVML
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtattcattattgccaccaaaataccctactcaaagacttcgccgaaatcgtagagat
gacttttctcgtcgcctcgtacaagaaaatcacctgagtccatctgactttatttatcca
gtgttcgtgcaagatgaacaaaaagagcctgttgcggtagcttcgttgccaggggtcttt
agacatagcattgaaagcctgcttccagttgctgaagaatgcgtaaagctcggaatccct
gttatagctttatttccagcggtggactcaaaccttaagacccccgatggcatcgaagcc
tgcaatcctgatggattgattccacgagttgttgagagacttaagaaagagttccccgct
cttggcattatgtgcgatgtggctctcgacccctatacaagccatggtcaggacggcatt
atcgacgaaaatggttatgttctaaatgatgaaactattgaagttctgcgaaaacaagct
ctcactcaagctcaagctggtgcggactatgtagctccaagcgatatgatggatggacgc
ataggtagggtgcgtgaaatattggatgaccacgatttgatttatacaaaaatcatggct
tattctgcaaaatatgccagctcgttctacggaccattccgtgatgccgtgggttctact
agcaatctaggtaaatcaaataaatttacatatcaaattgatcctgctaatagattagaa
gctttccacgaggttgctgccgatattcaagagggtgctgatttagtgatggtcaagcca
ggattaccttatttagatattttacgagaagttaaggatatgtttgctaaacctacattt
gcctatcaagttagtggtgaatactgcatgttgaaggcggcagctgcgaatggatggata
aatcataatgccgttatgatggaatccttgctatgttttaaacgtgcgggtgcagatggg
attttgacttattctgctattgaggctgcaaaattattaaaagtcatgttataa

DBGET integrated database retrieval system