KEGG   Taylorella equigenitalis ATCC 35865: KUI_1586Help
Entry
KUI_1586          CDS       T02186                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tea00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KUI_1586
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KUI_1586
Enzymes [BR:tea01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KUI_1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1707312..1708226)
Genome map
AA seq 304 aa AA seqDB search
MKKKIALVGVPTDVGAGHRGSSMGPEALRVAGISDRLLAMGFEVLDRGNLHGPVNPVRAP
ERGYRNFDEVVEWNRLTCDAIYDELKQGNLPIMLGGDHCLATGSISAVSRYVRESGKKLR
VIWLDAHTDFNTSESTPSGNMHGMPVACLFGHGPKEMIELSGIVPALTSDQIYQIGIRSV
DSIEKVLVHEAGHQVFDMRKLDEIGMREAMEFALDGLTDEYHLHVSFDVDFLDPEIAPGV
GTTVRGGPDYREAQLCMEMIADTGLISSLDIVELNPALDVQNLTANIACELVESLFGKNT
LVRQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaatcgcactagttggggtacccacagatgtgggagcaggtcataggggc
tcatctatgggtcctgaggctcttcgtgttgcaggtattagtgatagacttttggcgatg
gggtttgaagttttagatcgcggaaatctgcacggtcctgttaatcctgtacgtgcacca
gaaaggggttacaggaattttgatgaggtggttgagtggaatcgtcttacatgcgatgcg
atatacgatgaactaaagcaagggaatttgcccattatgctcggcggtgatcactgtttg
gctacaggatctataagtgcggtttctcgttatgtacgtgaaagcggtaagaagttgcgt
gtgatatggcttgatgcacacactgatttcaatacatcagaatctaccccaagtggcaat
atgcacggcatgcccgttgcatgcctttttggacatggtcctaaagagatgattgagtta
agtggtattgttcctgcactcacgtcagatcaaatatatcagattggcataagaagcgtt
gactctatcgagaaagtgttggtgcacgaagcgggtcatcaagtgtttgatatgcgtaag
ctagatgaaataggcatgcgtgaagcaatggagtttgcccttgatggtctaaccgatgag
tatcatctgcatgtaagtttcgatgttgattttttagacccagaaattgctcctggagtt
ggtactactgtacgtggtggacctgattaccgcgaagctcagctttgcatggagatgatt
gccgacactggcctaatttcttctcttgatattgtggagcttaatcctgcactagatgtt
cagaatttgactgctaatattgcgtgcgaacttgttgagagtttgtttggcaaaaatact
ttagtcagacagtga

DBGET integrated database retrieval system