KEGG   Taylorella equigenitalis 14/56: KUK_1205Help
Entry
KUK_1205          CDS       T02604                                 

Definition
putative disulphide bond isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
teg  Taylorella equigenitalis 14/56
Brite
Enzymes [BR:teg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KUK_1205
Secretion system [BR:teg02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   KUK_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1309327..1310193
Genome map
AA seq 288 aa AA seqDB search
MNNEVKVKFELNKLCGGLVLAFTAVTACVVSSVVVSADVVAQTASSVAQTTEKTKVPTTV
ESKSAGMKAGALPQDKVDNIKSNIEKTFQVKVLSVNPTPFADLYEVLTDETIIYTNADHN
YILAGHLIDAKSTVDLTDKRVKEQSAKAFASLPVEGAVKRVKGKGTRKLVTFEDPNCPYC
KALYKELEQMDDVTIYTFLVPLLAKDSVTKVRDIMCSSNPTLSWHEWVTDGKKPQSQANK
SCSEPNPKTFQLARSVNVQGVPVILFPNGERRNGFVRLADIEKIISSK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgaggtgaaagtgaaatttgaattaaataaattatgtggtggtctcgtgttg
gcatttactgctgtgactgcttgtgtcgtgtcatctgtggttgtgtcggcagatgtggtg
gctcagactgccagttccgtggctcaaactacagaaaagactaaagttcctacaactgtt
gaatctaaatctgcagggatgaaggcgggggcattgccacaagataaagtggacaatatt
aaatccaatatcgagaagacttttcaagttaaggttttaagcgtaaatccgacccctttt
gcggatttgtacgaagtattgacggatgagacgataatctatacaaatgcggatcataat
tatattttggcagggcatcttatcgacgctaagtcgacagttgatctgacggacaagcgt
gttaaagagcagtcagctaaggcatttgcaagcctgccagtggagggggctgttaagcgc
gtgaaaggaaaaggtacgcgtaaacttgtgacttttgaggacccgaattgcccatattgc
aaggctttatataaggagcttgagcagatggatgatgtcactatttatactttcttagtg
cccctattagcaaaggattctgtgactaaggtgcgggacattatgtgttcatcgaaccca
actctttcatggcacgagtgggttacagacggcaagaagccacaatctcaggctaataaa
agttgttctgagccaaaccctaaaacatttcagcttgctagaagcgttaatgtgcaggga
gtgccagtgatcttatttcctaatggagaacgaagaaacggttttgttcgtttagcggat
attgaaaaaattatttcttctaagtaa

DBGET integrated database retrieval system