KEGG   Thermosynechococcus elongatus: tll0439Help
Entry
tll0439           CDS       T00090                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tel  Thermosynechococcus elongatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    tll0439 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    tll0439 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    tll0439 (trpA)
Enzymes [BR:tel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     tll0439 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
complement(437946..438746)
Genome map
AA seq 266 aa AA seqDB search
MIVPKISERFEHCRARQRCALIPFLTAGDPDLETTVAALKILDDHGADLIELGMPYSDPL
ADGPVIQAAATRALQRGTRLEAVLEMTTDLHQQLTAPLILFSYYNPIYHRGVSSFLKAVA
QAGIKGLVIPDLPLEEAEPVLAETANLGLELTLLIAPTTSPERMRAIATASQGFIYLVST
TGVTGMRQEMASRVQELLHTLRQITPKPIGVGFGIASPEHARQVRDWGADAAIVGSAFVK
RLAEPDQGLAAVAEFCQSLRTALDTP
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtgcctaaaatttctgaacgctttgagcactgtcgtgctcgccagcgctgtgcc
ctcattccctttttgaccgccggagacccagatttagaaacgacagttgctgccctcaag
atcctagatgaccacggcgcagatttgattgaactggggatgccctattcagatcccttg
gccgatggtccagtgattcaggcagctgccacccgcgctctgcaacggggaacccgcctt
gaagccgtcttagaaatgacaacggacttgcaccagcaactgacggcgccgctcattctt
tttagctactacaatcccatctaccatcggggggtctcttcatttctcaaagcggttgcc
caagccgggatcaaggggttagtgattcctgatttgccccttgaggaagcagaaccggtt
ctcgcggagacggccaatttgggcttggaattgacactgctgattgcgcccaccacctcg
cccgaacggatgcgggcgatcgccaccgcttctcagggatttatttaccttgtcagcacc
actggcgtcactggcatgcgtcaagaaatggccagccgcgttcaggaactgttgcacacc
ctacggcagatcacccccaagcccattggtgttgggtttggcattgccagtccagagcat
gcccgccaggtgcgtgactggggcgctgatgccgccattgtcggcagtgcctttgttaaa
cgtctggcggaaccggatcaggggcttgccgctgttgctgagttttgtcagtcactccgc
accgccctcgatacgccctag

DBGET integrated database retrieval system