KEGG   Thermosynechococcus elongatus: tll0500Help
Entry
tll0500           CDS       T00090                                 

Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00900  Terpenoid backbone biosynthesis
tel01100  Metabolic pathways
tel01110  Biosynthesis of secondary metabolites
tel01130  Biosynthesis of antibiotics
Module
tel_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    tll0500
Enzymes [BR:tel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     tll0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 1012171
NCBI-ProteinID: NP_681290
CYORF: tll0500
UniProt: Q8DLJ1
Position
complement(494569..495504)
Genome map
AA seq 311 aa AA seqDB search
MYRLLAPAKINLFLQIIGNCLDGSGYHELVMVMQAVSLMDRLELIPRRDREIKVHCTNPA
VPCDQRNLAYKAAALLQQHFPDRDGVEIFIEKRIPLGAGLAGGSTNAAAVLVGLDLLWQL
GLTQGELQTLAAQLGADVPFCLQGGTALALGRGEQLTPLADLQGLTVILGKYRSLSVATP
WAYQTYRQEFAATYAQTPSEQEKARQEGGSAILLQAIQQHDIAPLAANLRNDLEKVVLPR
YPLVAELKEQFLAAGAIASMMSGSGPTVFALAPSADEGYRIMQRVRRALPDPDLDLWVCE
CCPHGIQLETS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgtatcgtctgctggcgcctgccaaaattaatctctttttacaaattattggcaactgt
ttggatggcagtggttaccacgagctagtaatggtcatgcaggcggtttccctcatggat
cgcctcgaactgattcctcggcgcgatcgcgagattaaggttcattgcacgaaccctgcc
gttccctgcgatcagcgaaatctggcctacaaagccgcagcactgctccagcagcatttt
ccggatcgcgatggtgttgaaattttcatcgaaaaacggattcctctgggggcgggcttg
gcgggagggtcaaccaatgccgcagcggtactcgtgggcttagatctcctgtggcagttg
gggctgacccaaggggaattgcaaaccttggcagcgcaattgggggccgatgttcccttc
tgtttgcagggagggactgccttggctttagggcgcggcgaacagttgactcccctggcg
gatctacaggggttaacggtgatcctagggaagtatcgctcccttagtgtggccacccct
tgggcctatcaaacctatcgccaggaatttgccgccacctatgcccaaacccccagcgaa
caggaaaaagcccgccaagaggggggatccgcaatcctgctacaggccattcagcagcat
gatattgccccattggcggccaacctccgtaatgatctagagaaagtggtgttgccccgc
tatcccttggtggcagagttaaaggagcaattcctggctgcgggagcgatcgccagcatg
atgtccggatctgggccaacggtttttgccctagcgccctctgccgatgagggctacagg
atcatgcaacgggtacggcgcgccctaccagaccccgatcttgatctatgggtctgtgag
tgctgtccccacggcattcagttggagacgtcctag

DBGET integrated database retrieval system