KEGG   Thermosynechococcus elongatus: tll0698Help
Entry
tll0698           CDS       T00090                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tel  Thermosynechococcus elongatus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    tll0698 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    tll0698 (trpC)
Enzymes [BR:tel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     tll0698 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(718882..719805)
Genome map
AA seq 307 aa AA seqDB search
MQIRRRPPNPAVTVRNLHYQVPVADDAPRNILEKIVWHKEQEVEQLREVLPLADLQRQVL
EAPPVRSFLAAVQNPVTQPALIAEVKKASPSKGIIRPNFDPVAIAQAYVAAGATCLSVLT
DSEFFQGSFEYLAQIRQEVAVPLLCKDFILYPYQMFLARVRGADAVLLIAAILSDKDLRY
FLRIAHGLGLTALVEVHTAEEMERVLALEDVQLVGINNRNLMDFSVDLATTEKLLANYGA
QLRDRNILVVSESGIHQRADVERMAQAGAQAILVGESLMRPPAAMAHFSEAEELRARIQQ
LFPELAH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcgccgccgtccccccaatcccgctgtcactgttcgcaacctccactaccaa
gtaccggtggccgatgatgcccctcgcaacattcttgagaagattgtttggcacaaggaa
caggaggtggagcaactgcgggaagtcctgcccttggctgatttacagcgtcaggtgctg
gaggcgccaccggtgcgttcttttttggcggctgtgcaaaaccctgtcacccaaccagcg
ctgattgctgaggtcaagaaggcctcccccagtaaaggcattattcgccccaatttcgac
ccggtggcgatcgcccaagcctacgttgccgcgggtgcaacctgcctttccgtcctaacg
gacagtgagtttttccagggcagctttgagtacctcgctcaaattcgccaagaggtggcg
gtgccgctgttgtgcaaggactttatcctctatccctaccagatgtttctggcaagggtg
cggggcgccgacgcagtgctactcatcgcggctatcctctcggacaaggatttgcgctat
tttctgcggattgcccatgggttgggtctaaccgcccttgtggaggtgcacaccgccgag
gagatggaacgggtgctggcactagaggacgtgcagcttgtggggatcaacaatcgcaac
ctgatggactttagtgttgatctggccactactgaaaaacttttggccaactatggggcg
caactgcgcgatcgcaacatccttgtggtcagcgaatcgggcattcatcagcgcgccgat
gtcgaacggatggcacaagccggcgcccaagccattttagtcggagaatccctaatgcgc
cccccagcggcgatggcacacttcagcgaggcggaggaactccgagcgcggattcagcag
ttatttccagagttagcccactag

  All links  
No link information was found.   
DBGET integrated database retrieval system