KEGG   Thermosynechococcus elongatus: tll0989Help
Entry
tll0989           CDS       T00090                                 

Definition
(RefSeq) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
tel  Thermosynechococcus elongatus
Brite
Enzymes [BR:tel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     tll0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 FSH1 Peptidase_S9 DLH UPF0227 Abhydrolase_2 Lipase_3 Thioesterase Esterase Abhydrolase_3 Ser_hydrolase BAAT_C
Motif
Other DBs
NCBI-GeneID: 1011333
NCBI-ProteinID: NP_681779
CYORF: tll0989
UniProt: Q8DK77
Position
complement(1013151..1013987)
Genome map
AA seq 278 aa AA seqDB search
MNAASSTSSDRGRFFMVVAWSRALVSLVNLPFFYGHGAGDRACLLLHGLGGGAYELQLLG
EVLYETGWTVQGILYPGHDRPSAQMPASTWLQWYEAVVTAFQALQESYSTVVVVGFSTGG
TLALHLAYHYSVDALVLLAPFLRIYRPWFFPVRPETLVQSLGRWIPWVPRRSLPIRDRPL
RQAAEEACFFKSFNLQAVGSALDLIAQVEQELPMITTPTLILQSRADTIVDPQGAQRIYE
NLGSSDKELHWLKDSDHLLPLDVERGQVFTKVVAFLGR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccgcctcctctacctcgagcgatcggggtagattttttatggtggtcgcgtgg
tcgagggcattggtgagtctggtcaatcttccctttttctatggccatggggcgggcgat
cgcgcctgtttgctcctccatggcttggggggcggagcctatgaactgcaactcttagga
gaagttctctatgaaacgggctggactgttcagggcattctctatccggggcacgatcgc
cccagtgcccaaatgcccgcctcgacatggctgcagtggtatgaggccgtcgtcaccgcc
tttcaagccttgcaagagagctactcaacggttgtggtggtcggcttttccacagggggg
accctagccctccatcttgcctatcactattccgttgatgccttagtgctccttgccccc
tttttgcgtatctatcggccttggtttttccccgtgagacccgagactctggtgcagtcc
ctgggtcgctggattccttgggtaccgcggcggagcctaccgattcgcgatcgccctctg
cgccaagcagcggaagaggcctgtttttttaagagtttcaatttacaggccgtaggcagt
gccctcgacctcattgcccaagtggagcaggagctgccaatgatcacaacgccgaccctg
attctccaaagtcgcgccgacaccatcgtagacccccaaggggcacaaaggatctatgaa
aacttaggcagttccgacaaggaattgcattggctcaaggattcggatcatttgctcccc
ctggatgtggagcgagggcaggtattcaccaaggtggtcgcctttttgggaagatag

DBGET integrated database retrieval system