KEGG   Thermosynechococcus elongatus: tll1227Help
Entry
tll1227           CDS       T00090                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tel  Thermosynechococcus elongatus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    tll1227 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    tll1227 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    tll1227 (thrC)
Enzymes [BR:tel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     tll1227 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1272620..1273786)
Genome map
AA seq 388 aa AA seqDB search
MAKIIVLCGCTLSSASNLFIFLDCVPVPVTLSAPPIRPAWHGLIHAYGDFLPVSDRTPVV
TLYEGNTPLIPVPQIAARIGRNVSVYVKYDGLNPTGSFKDRGMTMAISKAKEAGAEAVIC
ASTGNTSAAAAAYARRAGLRAYVLVPEGYVAQGKLAQALLYGAEVIAIEGNFDKALEIVR
LMAETYPVTLVNSVNPYRLEGQKTAAFEVVDSLGNAPDWLCIPMGNAGNITAYWMGFCQY
REQNRCDRLPRMMGFQAAGSAPLVKGEIVTHPETIATAIRIGNPANWQRAIAVKEASQGA
FNAVTDEEILKAYCLLASEEGIFCEPASAASVAGLLKLADQVPSGATVVCVLTGNGLKDP
ETALKQESDRFHRHIEPTEQTVAKVMGF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaattattgtactgtgcggctgcactctatcctcagcctcaaatttattcata
tttcttgactgcgtacctgtgcctgtaacactctctgctccccctatccgtcctgcttgg
catggcttaattcacgcctacggtgactttttgcccgtgagcgatcgcaccccagtggtc
accctctatgaggggaatacgccattgattccggtgcctcaaattgcagcgcggattggc
cgcaacgtctcagtttatgtcaagtacgacggcctcaaccccacagggagcttcaaggat
cggggcatgaccatggctatttccaaggccaaggaagcaggtgctgaggcggtgatttgt
gccagcacagggaatacctcagccgctgcggcggcctatgcccgacgagctggactacgc
gcctatgtcctagtgccagagggctatgttgcccaagggaaactcgcccaagcgcttctg
tatggcgctgaagttattgccattgagggcaactttgataaagccttggaaattgtccgc
ctcatggcggaaacctaccccgtgaccctagttaattccgtcaatccctatcggctggag
ggacagaaaacagcggcttttgaggtggtggatagcttgggcaatgcccccgactggctc
tgcattcctatgggcaatgccggtaacattacggcctactggatgggcttttgccagtat
cgtgagcaaaaccgttgcgatcgcctgccgcggatgatgggctttcaagcggcggggtcc
gctcccctagtcaagggtgagattgtgacgcatcccgaaaccattgcgacggcgattcgt
attggcaatcctgccaactggcagcgggcgatcgcggtcaaggaagccagccaaggggct
tttaatgccgttacagatgaggaaatcctgaaggcctattgtctgctggcctccgaggaa
gggattttctgtgaaccggcgagtgccgcttctgtggctggcctcttgaagttggccgat
caggtgcccagtggtgctacggtcgtttgtgtgctcacgggcaatggcctcaaggatcca
gaaaccgcgctcaagcaggagagcgatcgcttccaccgccacattgaacccacagaacaa
accgtggccaaggtgatgggcttttag

DBGET integrated database retrieval system