KEGG   Thermosynechococcus elongatus: tll1413Help
Entry
tll1413           CDS       T00090                                 

Gene name
chlD
Definition
magnesium-chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
tel  Thermosynechococcus elongatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    tll1413 (chlD)
Enzymes [BR:tel01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     tll1413 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1480062..1482068)
Genome map
AA seq 668 aa AA seqDB search
MTLAIAPFPITAIVGQEAIKLALLLAAVDPGLGGVIIAGRRGTAKSVLARGIHALLPPIE
VIDQGEIPVPIIANPDPECPQEWDSRLQAWRQSHPHGELKTKVIPAPFVQIPLGVTEDRL
LGAVDVSQSVQRGEAVFQPGLLAAAHRGVLYVDEMNLLDEQLANVLMAVLSAGRNQIERE
GISLDHPCRPLLIATFNPEEGEVPPHLLDRFAIALSADQVLGLDERVAAVDHATQFADSP
QAFLQQYEAELEDLRTQIILAREWLKEVKIQRQQIAYLVTEALRAGVQGHRAELFAVRVA
KAHAALNGRSEVNAEDLRRAVELVIVPRATQLEPPPEQPPPPPPPPPENQQSDPNAEPDE
PETPPEEQQQTPPIPEEFVFEADGTVLDESVLYFAQLTQRQGKSGSRSLIYSQDRGRYIR
PILPRGRGGRIAVDATLRSAAPYQKSRRLRQPQRRVIVENSDLRIKRLVRKAGALIIFVV
DASGSMALNRMNSAKGAVLRLLTQAYQNRDMVALIPFRGEQAEVLLPPTRSIEAARRRLE
TLPCGGGSPLAHGLTQAVRVGLNARQSGEIGQVMIVAITDGRGNVPLSRSLGETLPPQTK
PDVKAEVLEIAAKIQALGLKLLVIDTENKFVSTGMGKELAQQAGGKYYHLPKATDQAIAQ
VTQNALQF
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgcgatcgccccctttcccatcactgctatcgttggtcaagaggctattaag
ctggcactgctgttggccgccgttgatcccggtttggggggagtgatcattgcggggcgg
cgcggtactgccaaatccgtgctggcgcggggaattcatgccctattgccccctattgaa
gtcattgatcagggggagattccagtaccgatcattgccaaccccgaccctgaatgccct
caagagtgggatagccgcttgcaggcttggcgccaaagccatccccatggggagttgaaa
accaaagtcattccagccccctttgtgcaaattcccctaggggtaacggaggatcgcctc
ttgggggccgtggatgtgagtcaatcagtgcagcggggcgaagcggtttttcagcccggc
ctattggcggcagcccaccggggggtgctctatgtggatgaaatgaatctcttggacgag
caactggccaatgtcctgatggcggtgcttagtgctgggcgcaaccaaatcgagcgggag
gggattagtctagatcatccctgtcgtccccttttaattgccacgtttaaccccgaagaa
ggggaagtcccaccccatctgctcgatcgatttgcgatcgccctatcagcggatcaggtg
ctgggcttggatgagcgggtcgcagcggtggatcatgccacccaatttgcggattcgccc
caggcctttttgcagcagtacgaagctgagctagaggatctgcgcacccaaattatcctg
gcgcgggaatggctcaaggaggtgaaaattcaacggcagcaaattgcctatctcgtcacc
gaagccctacgagccggcgtgcagggtcatcgggcagaactctttgcggtgcgggtagcc
aaagcccacgctgcccttaatggtcgtagtgaagtcaatgccgaggacctccgccgcgct
gttgaactggtgattgtgccgcgagccactcaactggaaccgcccccggagcagccaccg
ccacccccgccgccccccccagagaaccagcagtctgaccccaacgcagaacccgatgaa
ccagagacgccaccggaagagcagcagcagaccccacccattcctgaagaatttgtcttt
gaagccgatggcacggtcttggatgagtcagtgctctactttgcccaactgacccaacgc
caagggaaatcggggagtcgcagcctcatttactcccaagatcgcggtcgctacatccgc
cccattttgccccgtggtcgaggggggcgaattgccgtggatgccaccctgcgcagcgcg
gctccctaccaaaaatcccgtcgcctacgtcaaccccaacgccgcgttattgttgaaaac
agtgatctgcggatcaaacgcctagtgcgcaaagcgggtgccttgattatctttgttgtg
gatgcctctgggtcgatggcgctgaaccggatgaactccgccaaaggagctgtcctacgc
cttttgacccaagcctatcaaaaccgtgatatggtggctctcattccctttcgcggtgaa
caggcagaggtgctcctaccccccacccgctccattgaggcagcgcggcggcgcctggaa
acgctcccctgtgggggtggctccccccttgcccacggcctcacccaagcggtacgggtg
ggcttgaatgcccgccaaagcggtgaaattggtcaagtgatgattgtggccatcaccgat
ggtcggggcaacgtccccttgagccgttcccttggggaaaccctaccgccgcagacgaag
ccggatgtcaaagccgaggtactggaaattgccgccaagattcaagccctgggtctaaag
ctcttggtcattgatactgagaataagtttgtctccacagggatgggcaaggaattggca
cagcaagcggggggtaagtattaccatctacctaaggccaccgatcaggcgatcgcccaa
gtcacccagaacgccctgcaattttag

  All links  
No link information was found.   
DBGET integrated database retrieval system