KEGG   Thermosynechococcus elongatus: tll1466Help
Entry
tll1466           CDS       T00090                                 

Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
tel  Thermosynechococcus elongatus
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    tll1466
   01230 Biosynthesis of amino acids
    tll1466
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    tll1466
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    tll1466
Enzymes [BR:tel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     tll1466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1528574..1529587)
Genome map
AA seq 337 aa AA seqDB search
MVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQDAE
ITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKKV
LITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMTTT
HSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTPN
VSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDASL
TMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtggttagagtcgctatcaatggttttgggcgcatcggtcggaacttcatgcgttgctgg
ttacagcggaaagccaatagcaagctagagattgtaggcatcaacgatacctccgatccc
cgcaccaatgcccatttgctaaagtatgactcgatgttgggcattttccaggatgccgaa
atcactgctgacgacgactgtatctatgccggcggccatgcggttaaatgcgtgtctgat
cgcaaccctgaaaatctgccttggagcgcttggggaattgatctggtcattgaagccacg
ggggtctttaccagccgtgagggggcaagcaaacacctgagcgccggtgcgaaaaaagtt
ctgatcacagcacccggcaaaggcaacatccccacctatgtggtcggggtaaatcaccac
acctacgatccgagtgaggatatcgtcagcaatgccagttgcaccaccaactgcctagcc
cccattgtcaaagtgctccatgaagcctttggcattcagcaggggatgatgacgacaacc
cacagttacactggggatcaacgcctgctcgatgcgagtcaccgcgatctgcggcgagcc
cgggcagcagcgatgaacattgtgcccacttctacgggggctgctaaggcagtcgggcta
gtgattcctgaattgcaagggaagctaaacgggattgccctgcgggtacccacgcccaat
gtttctgtggtcgactttgtcgctcaggtggaaaaacccaccattgctgagcaggtcaac
caggtcatcaaggaggcctctgaaaccactatgaaggggattatccactacagtgaactg
gagcttgtgtcttccgactatcggggtcacaatgcctcctcaattttggatgcgtcccta
acgatggtgctggggggcaatttagtgaaagtggtggcttggtacgataacgagtggggc
tatagccagcgggttctggatttggcagagcacatggccgcccactgggcttag

DBGET integrated database retrieval system