KEGG   Thermosynechococcus elongatus: tll1466Help
Entry
tll1466           CDS       T00090                                 

Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00010  Glycolysis / Gluconeogenesis
tel00710  Carbon fixation in photosynthetic organisms
tel01100  Metabolic pathways
tel01110  Biosynthesis of secondary metabolites
tel01120  Microbial metabolism in diverse environments
tel01130  Biosynthesis of antibiotics
tel01200  Carbon metabolism
tel01230  Biosynthesis of amino acids
Module
tel_M00002  Glycolysis, core module involving three-carbon compounds
tel_M00165  Reductive pentose phosphate cycle (Calvin cycle)
tel_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
tel_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    tll1466
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    tll1466
Enzymes [BR:tel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     tll1466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-GeneID: 1011280
NCBI-ProteinID: NP_682256
CYORF: tll1466
UniProt: Q8DIW5
Structure
PDB: 

Jmol
Position
complement(1528574..1529587)
Genome map
AA seq 337 aa AA seqDB search
MVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQDAE
ITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKKV
LITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMTTT
HSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTPN
VSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDASL
TMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtggttagagtcgctatcaatggttttgggcgcatcggtcggaacttcatgcgttgctgg
ttacagcggaaagccaatagcaagctagagattgtaggcatcaacgatacctccgatccc
cgcaccaatgcccatttgctaaagtatgactcgatgttgggcattttccaggatgccgaa
atcactgctgacgacgactgtatctatgccggcggccatgcggttaaatgcgtgtctgat
cgcaaccctgaaaatctgccttggagcgcttggggaattgatctggtcattgaagccacg
ggggtctttaccagccgtgagggggcaagcaaacacctgagcgccggtgcgaaaaaagtt
ctgatcacagcacccggcaaaggcaacatccccacctatgtggtcggggtaaatcaccac
acctacgatccgagtgaggatatcgtcagcaatgccagttgcaccaccaactgcctagcc
cccattgtcaaagtgctccatgaagcctttggcattcagcaggggatgatgacgacaacc
cacagttacactggggatcaacgcctgctcgatgcgagtcaccgcgatctgcggcgagcc
cgggcagcagcgatgaacattgtgcccacttctacgggggctgctaaggcagtcgggcta
gtgattcctgaattgcaagggaagctaaacgggattgccctgcgggtacccacgcccaat
gtttctgtggtcgactttgtcgctcaggtggaaaaacccaccattgctgagcaggtcaac
caggtcatcaaggaggcctctgaaaccactatgaaggggattatccactacagtgaactg
gagcttgtgtcttccgactatcggggtcacaatgcctcctcaattttggatgcgtcccta
acgatggtgctggggggcaatttagtgaaagtggtggcttggtacgataacgagtggggc
tatagccagcgggttctggatttggcagagcacatggccgcccactgggcttag

DBGET integrated database retrieval system