KEGG   Thermosynechococcus elongatus: tll1511Help
Entry
tll1511           CDS       T00090                                 

Gene name
chlI
Definition
(RefSeq) magnesium-chelatase subunit
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00860  Porphyrin and chlorophyll metabolism
tel01100  Metabolic pathways
tel01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    tll1511 (chlI)
Enzymes [BR:tel01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     tll1511 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 DUF815 AAA ABC_tran AAA_28 AAA_18 AAA_19 AAA_30 AAA_27 RNA_helicase MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 1011134
NCBI-ProteinID: NP_682301
CYORF: tll1511
UniProt: Q8DIS0
Position
complement(1580011..1581114)
Genome map
AA seq 367 aa AA seqDB search
MWHNSQCCFCDVMPVTATAVPRRPVFPFAAIVGQDEMKLSLLLNVIDPKIGGVMIMGDRG
TGKSTTIRALADLLPEIEVVADDPFNSHPSDPDLMSDAVKVAVAAGEPIHTIKKKVPMVD
LPLGATEDRVCGTIDIEKALAEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDAA
ASGWNTVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPTLRVEIV
EQRSQFDQNPEAFLAKYQAQQEALQAKLVAAQALLPKVTIDHELRVKISQVCAELDVDGL
RGDIVTNRAAKALAAFEGRTEVTVEDIARVIVLCLRHRLRKDPLESIDSGYKVGKVFQEV
FGVEIAT
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtggcacaatagtcaatgctgtttttgcgatgtgatgcctgtgactgcgactgctgtc
cctcgtcggcctgtttttccctttgcggcaattgtcggtcaagacgaaatgaaactgtca
ttgttgctcaatgtcattgaccccaaaattggtggggtgatgatcatgggcgatcgcggc
acgggcaaatcaaccactattcgtgccctagcggatttgctgccagaaattgaggtggtt
gccgatgaccccttcaatagtcaccccagtgatcccgatctcatgagcgatgccgtgaag
gtggctgtggcagccggtgaacccattcacaccatcaagaaaaaggtacccatggtggat
ctgcccctgggagccacagaagatcgggtgtgcggcacgattgacattgaaaaagccctt
gctgagggggtgaaagcctttgagccgggactgttggccaaggcaaatcgcggcattctc
tatgtggatgaggtgaacctgctggatgatcacttagtggatgtcctcctggatgccgct
gcctccggctggaataccgttgagcgtgaggggatttcaattcgtcatccagcccgcttt
gtcctagttggctctggtaatcctgaagaaggggaattgcgaccccaactgctagatcgc
tttggcatgcacgctgagattcgcaccgtcaaggacccaaccctgcgggtggaaattgtg
gaacagcgatcgcaatttgatcaaaatcccgaggcctttttggcgaaataccaggcgcaa
caggaagccctgcaagccaagttggtcgctgcccaagccctattgcccaaggtcaccatt
gaccacgagctgcgagtgaaaatttcccaagtgtgtgctgagctggatgtggacggcctg
cggggagacattgtcactaaccgcgcggccaaggccttggcggcctttgagggacgcacg
gaggtcactgttgaggatattgcgcgggtgattgttctctgtctgcggcaccgattgcgc
aaggatcccctagagtctattgactccggctacaaggtcggcaaagtcttccaagaggtt
tttggggtggagattgcgacctag

DBGET integrated database retrieval system