KEGG   Thermosynechococcus elongatus: tll1511Help
Entry
tll1511           CDS       T00090                                 

Gene name
chlI
Definition
magnesium-chelatase subunit
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tel  Thermosynechococcus elongatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    tll1511 (chlI)
Enzymes [BR:tel01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     tll1511 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1580011..1581114)
Genome map
AA seq 367 aa AA seqDB search
MWHNSQCCFCDVMPVTATAVPRRPVFPFAAIVGQDEMKLSLLLNVIDPKIGGVMIMGDRG
TGKSTTIRALADLLPEIEVVADDPFNSHPSDPDLMSDAVKVAVAAGEPIHTIKKKVPMVD
LPLGATEDRVCGTIDIEKALAEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDAA
ASGWNTVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPTLRVEIV
EQRSQFDQNPEAFLAKYQAQQEALQAKLVAAQALLPKVTIDHELRVKISQVCAELDVDGL
RGDIVTNRAAKALAAFEGRTEVTVEDIARVIVLCLRHRLRKDPLESIDSGYKVGKVFQEV
FGVEIAT
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtggcacaatagtcaatgctgtttttgcgatgtgatgcctgtgactgcgactgctgtc
cctcgtcggcctgtttttccctttgcggcaattgtcggtcaagacgaaatgaaactgtca
ttgttgctcaatgtcattgaccccaaaattggtggggtgatgatcatgggcgatcgcggc
acgggcaaatcaaccactattcgtgccctagcggatttgctgccagaaattgaggtggtt
gccgatgaccccttcaatagtcaccccagtgatcccgatctcatgagcgatgccgtgaag
gtggctgtggcagccggtgaacccattcacaccatcaagaaaaaggtacccatggtggat
ctgcccctgggagccacagaagatcgggtgtgcggcacgattgacattgaaaaagccctt
gctgagggggtgaaagcctttgagccgggactgttggccaaggcaaatcgcggcattctc
tatgtggatgaggtgaacctgctggatgatcacttagtggatgtcctcctggatgccgct
gcctccggctggaataccgttgagcgtgaggggatttcaattcgtcatccagcccgcttt
gtcctagttggctctggtaatcctgaagaaggggaattgcgaccccaactgctagatcgc
tttggcatgcacgctgagattcgcaccgtcaaggacccaaccctgcgggtggaaattgtg
gaacagcgatcgcaatttgatcaaaatcccgaggcctttttggcgaaataccaggcgcaa
caggaagccctgcaagccaagttggtcgctgcccaagccctattgcccaaggtcaccatt
gaccacgagctgcgagtgaaaatttcccaagtgtgtgctgagctggatgtggacggcctg
cggggagacattgtcactaaccgcgcggccaaggccttggcggcctttgagggacgcacg
gaggtcactgttgaggatattgcgcgggtgattgttctctgtctgcggcaccgattgcgc
aaggatcccctagagtctattgactccggctacaaggtcggcaaagtcttccaagaggtt
tttggggtggagattgcgacctag

DBGET integrated database retrieval system