KEGG   Thermosynechococcus elongatus: tll1719Help
Entry
tll1719           CDS       T00090                                 

Gene name
desC3
Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tel  Thermosynechococcus elongatus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tel01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:tel01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1800682..1801521)
Genome map
AA seq 279 aa AA seqDB search
MTSSLELQPQTSRLNWGFVLFLGAVHILAAVALFFFSWSALAVTIFLHWLFGSIGICLGY
HRLLSHRSFQVPQWLEYVIAVVGALAMQGGPIFWVAGHRLHHAHTEDEIKDPYSARRGFW
WSHMLWLVYPQSQFFNAEEYARFAPDLTRDPFYRWLDRYFLLLQLPLALLLYGLGGWSWL
LWGMFMRAVFLWHSTWLINSATHKWGYRRFETEDNSRNLWWAALLTYGEGWHNNHHAYPH
VAKAGWYWWEVDPTWWVIRTLQGLGLAAKVQLPPPKALS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacatcatccttagaattgcaaccccagacctcccgcctcaattggggctttgtcctc
tttttaggggcggtgcatattttagccgcggttgcgcttttctttttctcctggtcggca
ttggccgtcaccatctttctgcactggctctttggcagtatcggtatttgcttgggatac
catcgtcttttaagtcaccgcagtttccaagtgccccaatggttggagtacgtcattgct
gttgtgggtgccttggccatgcagggaggcccgattttttgggtggcagggcaccgctta
caccatgcccacaccgaggatgagattaaagatccctactcagcacggcggggcttttgg
tggagtcatatgctgtggctcgtctatccgcagtcccagtttttcaatgccgaggagtat
gcccgctttgcccctgacctcacacgagatcccttttaccgctggctagatcgctacttt
ttactcctgcagcttccccttgcgctgctcctctatggcttagggggttggtcctggttg
ttgtgggggatgtttatgcgagccgtttttctttggcacagcacttggttgattaactct
gccacccacaaatggggctatcgtcgctttgagactgaggataactcacgcaatctctgg
tgggcagccctcctcacctatggtgaaggttggcacaacaaccaccatgcctatccccac
gttgccaaggcgggctggtactggtgggaagtggatcccacctggtgggtgattcgcaca
ctccaaggactcggtcttgccgccaaggtacagttgccaccgcccaaagcgttgtcctaa

DBGET integrated database retrieval system