KEGG   Thermosynechococcus elongatus: tll2118Help
Entry
tll2118           CDS       T00090                                 

Gene name
proB
Definition
(RefSeq) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00330  Arginine and proline metabolism
tel00332  Carbapenem biosynthesis
tel01100  Metabolic pathways
tel01130  Biosynthesis of antibiotics
tel01230  Biosynthesis of amino acids
Module
tel_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    tll2118 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    tll2118 (proB)
Enzymes [BR:tel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     tll2118 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 1011467
NCBI-ProteinID: NP_682908
CYORF: tll2118
UniProt: Q8DH42
Position
complement(2203364..2204473)
Genome map
AA seq 369 aa AA seqDB search
MAQTLVVKIGTSSLAGGKEGNLALATIAQLVEVLCHCQRRGDRVVLVSSGAVGVGAMRLG
LTERPQQLAQKQAVAAVGQGHLMRMYDDLFAVLRQPIAQILVTRQNFVDRQSYLNIYNTF
QALFELGVIPIVNENDTVAVDELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSADPRI
DKTAVPIERVVSLAELAQTIQVGSAGSPWGTGGMATKIRAAEIATEAGVRTVITDGRSPT
NLLKILGGEALGTHFEPRPKTINARKRWIARALIPKGELWLDEGAVKAITVGGKSLLAAG
ITRVEGEFQAQDAVKLCDPTGAEIARGLVNYNSEEIRRVQGQQSTELANILGYAGADTIV
HRDNLVVTL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaacactggtcgtcaaaattggcacatcgagcttagcggggggcaaagaagga
aacctagccttggccaccattgcccaactggtggaggtgctgtgtcactgtcaacggcgg
ggcgatcgcgtggtgctcgtctcctctggggcggtgggcgtgggtgctatgcgcttgggc
ctgacagaacgtccccaacaattagcccaaaaacaagcagtggcagcagtgggtcaagga
cacctgatgcggatgtacgatgatctctttgcggtcctgcgtcagcccattgcccaaatc
ctggtgacacggcaaaattttgtcgatcgccagagctacttgaatatctacaacacgttc
caagcactgtttgaattgggggtcatccccattgtcaatgagaacgatacagtggcggtg
gatgaactcaagtttggtgacaatgataccctctcagcccttgtggcaagtcttgtcgaa
gccgattggttatttttgctcacagatgtcgatcgcctctattcagccgatccacgcatt
gataagaccgctgttcccattgagcgggtcgtctccttggccgagttagcacaaaccatt
caagttgggtctgctggctccccttggggcaccggcggcatggccaccaaaattcgggct
gcggaaattgccacagaagccggcgtgcgcaccgtcattaccgatgggcgatcgcccacc
aacctcctgaaaatccttgggggtgaagccttgggcacccactttgaacctcgtcccaaa
accatcaatgcccgtaaacgctggattgcccgtgccctcattcccaaaggcgagttatgg
ctagatgagggtgccgttaaggcaatcaccgtgggtggcaagtccctcttagcagcaggc
attacccgtgtggaaggggagtttcaggctcaagatgctgtgaagctctgtgaccccaca
ggagccgaaattgcccgtggccttgtcaactacaacagtgaagaaattcgtcgtgtccaa
gggcaacaatctacggaattggccaacatcctcggctatgccggtgccgatacaattgtc
caccgtgacaacctagtggtgaccctgtaa

DBGET integrated database retrieval system