KEGG   Thermosynechococcus elongatus: tll2204Help
Entry
tll2204           CDS       T00090                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tel  Thermosynechococcus elongatus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tel03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2288299..2288907)
Genome map
AA seq 202 aa AA seqDB search
MSSVYTRPLARLIEQLQRLPGIGPKTAQRLALHLIKRPEADIQALAQALLEAKQQVGLCS
VCFHLSAEPVCEICASPQRDNHTICVVADSRDVIAIEKTREYHGKYHVLGGLISPLEGIT
PEHLHIQPLIQRASQPQVEEVILAINPSIEGETTTLYVGQLLRPFVKVTRIAFGLPVGGD
LDYADEMTLARALAGRREIEWQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgtttatacccgtccccttgctcgcctcattgagcagttgcagcgcttgccg
gggattggcccaaagactgcccaacggctcgctctccacctcatcaaacgtcctgaagcg
gatatccaagccctagctcaggctcttcttgaggccaaacagcaggtgggactttgttca
gtgtgttttcatctctctgcagagccggtgtgtgaaatctgtgcctcgccccagcgagac
aatcacacgatttgcgtggttgcggattcccgcgatgtcattgccattgaaaaaacccgc
gagtaccacggcaagtaccatgttttgggcggactcatttcacccctagagggcattact
cccgaacacctgcacattcaaccgctcattcagcgcgccagccaaccgcaggtggaagaa
gtgatcctggccatcaaccccagtatcgaaggggaaaccaccacgctctatgtgggacag
ctgctgcgtccctttgtcaaagtaacccgcattgcctttggcctacccgtgggtggtgat
ctcgactatgccgatgaaatgacccttgcccgtgccctcgctggccgccgcgagattgag
tggcagtag

DBGET integrated database retrieval system