KEGG   Thermosynechococcus elongatus: tll2204Help
Entry
tll2204           CDS       T00090                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
tel  Thermosynechococcus elongatus
Pathway
tel03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tel00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    tll2204 (recR)
DNA repair and recombination proteins [BR:tel03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     tll2204 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      tll2204 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8 HHH_3 IMS_HHH Cdd1 DNA_pol_lambd_f
Motif
Other DBs
NCBI-GeneID: 1010793
NCBI-ProteinID: NP_682994
CYORF: tll2204
UniProt: Q8DGV8
Position
complement(2288299..2288907)
Genome map
AA seq 202 aa AA seqDB search
MSSVYTRPLARLIEQLQRLPGIGPKTAQRLALHLIKRPEADIQALAQALLEAKQQVGLCS
VCFHLSAEPVCEICASPQRDNHTICVVADSRDVIAIEKTREYHGKYHVLGGLISPLEGIT
PEHLHIQPLIQRASQPQVEEVILAINPSIEGETTTLYVGQLLRPFVKVTRIAFGLPVGGD
LDYADEMTLARALAGRREIEWQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgtttatacccgtccccttgctcgcctcattgagcagttgcagcgcttgccg
gggattggcccaaagactgcccaacggctcgctctccacctcatcaaacgtcctgaagcg
gatatccaagccctagctcaggctcttcttgaggccaaacagcaggtgggactttgttca
gtgtgttttcatctctctgcagagccggtgtgtgaaatctgtgcctcgccccagcgagac
aatcacacgatttgcgtggttgcggattcccgcgatgtcattgccattgaaaaaacccgc
gagtaccacggcaagtaccatgttttgggcggactcatttcacccctagagggcattact
cccgaacacctgcacattcaaccgctcattcagcgcgccagccaaccgcaggtggaagaa
gtgatcctggccatcaaccccagtatcgaaggggaaaccaccacgctctatgtgggacag
ctgctgcgtccctttgtcaaagtaacccgcattgcctttggcctacccgtgggtggtgat
ctcgactatgccgatgaaatgacccttgcccgtgccctcgctggccgccgcgagattgag
tggcagtag

DBGET integrated database retrieval system