KEGG   Thermosynechococcus elongatus: tll2475Help
Entry
tll2475           CDS       T00090                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tel  Thermosynechococcus elongatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    tll2475 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    tll2475 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    tll2475 (trpB)
Enzymes [BR:tel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     tll2475 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2590199..2591431)
Genome map
AA seq 410 aa AA seqDB search
MTVAPSAALSAAARPDARGRFGRFGGKYVPETLMPALSELEAAFAHYRQDPDFQAELQQL
LRDYVGRPSPLYFAERLSAHYAHDQVQPQIYLKREDLNHTGAHKINNALGQVLLAKRMGK
QRIIAETGAGQHGVATATVCARFGLQCVIYMGVQDMERQRLNVLRMRLLGAEVAPVSAGT
GTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVREFHAVIGAETRQQCLEKWGGL
PDILLACVGGGSNAMGLFHEFVEEPQVRLIGVEAAGQGLDTGHHAATLTKGEVGVLHGAM
SYLLQDADGQVVEAHSISAGLDYPGVGPEHSYLKDIGRAEYYSVTDTEAVAACVRLAQLE
GILPALETAHALAYLETLCPQLTGQPRIVINCSGRGDKDVETIGRYFEAQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgactgttgccccctctgctgccctcagtgctgctgctcgccccgatgcccggggtcgc
tttggtcgctttggtggcaagtatgttcctgaaaccctgatgcccgccctcagtgaattg
gaggcggcctttgcccactaccgccaagaccctgacttccaagcagaattgcagcagctc
ctgcgggattatgttggtcgccccagtccactctactttgccgaacgccttagcgcccac
tatgcccatgatcaggtccaaccgcaaatttacctcaagcgggaggacctgaatcacacc
ggtgcccataaaatcaacaacgccctcggtcaggttctcctcgccaaacgcatgggcaaa
cagcgcattattgctgaaacaggcgccggtcagcatggggtagccacagcaacggtgtgt
gcccgctttggcctccaatgtgtgatttacatgggggtacaggatatggagcggcagcgg
ttaaatgtgttgcggatgcgtctattgggagcagaagtggcccccgtcagtgccggcaca
ggaaccctcaaagatgccacctcagaagcaattcgcgattgggtgacaaatgttgaaacc
acccattacatcttgggttcagtggcaggcccccatccctacccaatgctcgtacgggaa
ttccacgccgtcattggggctgaaacccgccagcagtgccttgagaaatggggcggtctg
ccggatattctccttgcctgtgttggtggtggctcaaatgccatgggactgttccatgaa
tttgttgaggaaccccaagtgcgcttaattggtgttgaagctgccggtcaagggctggac
accggtcaccatgccgccaccctcaccaaaggggaagtgggagtgctccacggcgccatg
agctatctattgcaggatgccgatggtcaggtggttgaggcccactccattagcgctggt
ttagactatccaggggtggggccagagcacagctacctcaaggacattggtcgggcagaa
tactacagtgtcaccgatactgaggcggtggcggcctgtgtgcgcctcgctcagttggag
gggattctccccgccctggaaaccgcccatgccttggcctacctggaaaccctatgcccc
caattgacgggtcagccgcgcatcgtcattaactgttcaggacgtggcgataaggacgtg
gaaaccattggccgttatttcgaggcgcagtag

DBGET integrated database retrieval system