KEGG   Thermosynechococcus elongatus: tlr0193Help
Entry
tlr0193           CDS       T00090                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
tel  Thermosynechococcus elongatus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    tlr0193
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    tlr0193
Enzymes [BR:tel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     tlr0193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
174461..176881
Genome map
AA seq 806 aa AA seqDB search
MPSDGAALKRYSGSGASSENGVIEFANCAWTRAIGQGWETPYRVRYASNLDDGPWYGMPL
GGFGAGCIGRSSAGDFNLWHVDGGEHIFGTLPACQFSLFEQGEQTQAYALGSAPKDGRLS
SWQWYPAGKGTYAVRYPRSWFVYEGVFRAQITCEQFSPILPHNYQETSYPVAVFLWTFSN
PTDQSLTLSLMLSWQNTVGWFCNTTPSSAIAIRDDGSPVYTYTPRWGQSDGNFNELIQTE
SFQGWRLRRMPHPNPPQEGDGEWAALIPTGLGEFFGCSRWQPEGDGAHLWQSFSVDGSLP
FVNDPTPAAAGEQVAAAFALRFSLAPGERKQIPVVLAWDFPVTEFGKGVIYYRRYTDFCD
RHGTNAVTLAAQALAAYATWQEQIRTWQAPILSHPDWPDWFKMALCNELYVLSSGGSLWS
AASDRDPVGQFAVLECLDYRWYESLDVRLYGSFALLQLWPELEKSVMRAFARAIPTADPT
LRIIGYFYRGDPETAYKAPRKLANAVPHDLGAPNEHPWEKTNYTAYQDCNLWKDLASDFV
LLVYRDFLFTGGTDLNFARECWPAVVAALDHLKQFDQDGDGLPENGGAPDQTYDDWKLQG
VSAYCGGLWLAALEAAIALGTLLQQPQVEIYRQWLSQARPRYHQLLWNGEYYRLDTGSGS
DVIMADQLCGQFYAQLLGLVDIVPPDCCDRALRKIYDTCFLKFHNGQFGAANGLLPNGQP
ENPHATHPLEVWTGINFGLAAFLWQRGMIDEAWRLAEVVVRQIYENGLQFRTPEAITANG
TFRACMYLRPMAIWALALVSGGSRLP
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
gtgccaagtgatggcgcagcgctaaagcggtattctggatcaggggcgtcttcggaaaat
ggtgtgattgaatttgccaactgtgcttggactcgggcgatcggccaaggttgggagact
ccttatcgcgttcgctatgccagcaatttagacgatggcccttggtatggaatgcccctt
ggtggctttggcgctggctgtattggccgttcttctgcgggggactttaacctttggcac
gttgatggcggagagcacatctttggcaccctgcccgcctgtcaatttagtctttttgag
cagggagagcaaacacaggcctatgccctaggcagtgcccccaaggatggccgcctcagc
agttggcagtggtaccccgctggcaaaggcacctatgcggtgcggtacccgcggagttgg
tttgtctatgagggggtctttagggcccaaatcacctgtgaacagttttcaccgattcta
ccccacaactaccaagaaaccagttacccggtggcggtgtttctgtggacattcagcaat
cccacagatcagtccctcaccctaagcctaatgctctcgtggcaaaataccgtcggttgg
ttttgcaatactaccccttcctcggccattgctatccgtgatgatggtagccctgtctat
acctacacgccccgctggggtcaaagtgacggcaattttaatgaactgattcaaacggag
tcgtttcaaggttggcgactgcgccgtatgccccaccccaacccaccccaagaaggggat
ggcgaatgggcagcattgattcccacaggcctgggcgagttttttggctgtagtcgctgg
cagccagagggggatggggcacacctgtggcaatcattttctgtggatggttccctaccc
tttgttaatgatcccaccccagcggcagcgggagagcaggtggccgccgcttttgccctg
cgcttttccttagcaccgggggaaagaaaacaaattcctgtggtcctagcgtgggacttt
cccgtgaccgagtttggcaagggagtgatctattaccgtcgttacacggatttttgcgat
cgccacggtactaatgccgtcacccttgccgcccaagccctcgccgcctatgccacgtgg
caagagcagattcgcacttggcaagcaccgatcctcagtcaccccgactggccggactgg
ttcaagatggcactgtgcaatgagctatacgttctcagtagtgggggcagcctctggagt
gcagccagcgatcgcgatcctgtgggtcagtttgccgttttagaatgccttgactaccgc
tggtatgaaagtctggatgtgcgtctttatggttcctttgccctgctgcaattgtggcca
gagctggaaaaatccgtgatgcgtgcctttgcgcgggccattccgacagcagatccaacc
ctgagaatcattggctacttctatcgcggtgatcccgaaaccgcctacaaagcgcctcgt
aaactggccaatgccgtcccccacgatctcggtgcccccaatgagcacccttgggaaaag
accaactacacggcctaccaagactgtaatctgtggaaagatttggcctcggattttgtg
ctcttggtctatcgcgactttttgttcacgggggggacggatctcaattttgcccgggag
tgctggccggcggtggtggccgccctagaccatttgaaacaatttgaccaggatggcgat
ggcctgccagaaaatgggggtgccccggatcaaacctacgatgactggaaactacaggga
gtcagtgcctactgtggtggcttgtggttggcagccctagaggcggcgatcgccctcggc
acgcttctccaacaaccgcaggtggagatctaccgccagtggcttagccaagctcggccc
cgctaccatcaactgctgtggaatggcgagtactatcgtctcgataccggcagtggctcc
gatgtgatcatggcggatcaactgtgtggccagttttatgcccaactcctgggcctggtg
gatattgtgcccccggactgttgcgatcgcgccctgcgcaaaatttacgacacctgtttt
ctcaaatttcacaacggccagttcggtgccgccaatggcctattgcccaacggccaacct
gaaaacccccacgctacccatccccttgaagtgtggacggggattaactttggtttggct
gcctttttatggcagcggggaatgatcgacgaagcatggcgtttagccgaagtggtggta
cggcaaatctacgagaatggcctgcaatttcgtacgccggaggcgattacggccaatggt
accttccgtgcctgtatgtacctgcgccctatggccatctgggcactggcccttgtcagt
gggggatcacgattgccctaa

DBGET integrated database retrieval system