KEGG   Thermosynechococcus elongatus: tlr0227Help
Entry
tlr0227           CDS       T00090                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
tel  Thermosynechococcus elongatus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    tlr0227
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    tlr0227
   00620 Pyruvate metabolism
    tlr0227
   00650 Butanoate metabolism
    tlr0227
  Lipid metabolism
   00071 Fatty acid degradation
    tlr0227
  Amino acid metabolism
   00350 Tyrosine metabolism
    tlr0227
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    tlr0227
   00626 Naphthalene degradation
    tlr0227
Enzymes [BR:tel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     tlr0227
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     tlr0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
207894..210551
Genome map
AA seq 885 aa AA seqDB search
MNAPTLTSDPPVQSLADLEGLIERVQRAQSQYAQFTQEQVDHIFHEAAMAANQARIPLAK
QAVAETGMGVVEDKVIKNHFASEYIYNKYKNEKTCGVIEDDPIFGIQKIAEPVGIIAGVV
PVTNPTSTTIFKALIALKTRNGIIFSPHPRAKACTVAAAKVVLDAAVAAGAPPDIIGWID
EPTIELSQALMQHPQIKLILATGGPGMVKAAYSSGHPAIGVGAGNTPVLIDATADIPTAV
SSILLSKAFDNGMICASEQAVIVVDEIYDALKAEFQRRGAYLLSPEERQQVAQLLLKDGR
LNAAIVGQSAATIAAMANIQVPPETRVLIGEVSEVGPQEPFSYEKLCPVLALYRAPQFHK
GVEIAAQLVNFGGKGHTSVLYTDPRNQDDIAYFKYRMQTARVLINTPSSQGAIGDLYNFK
LDPSLTLGCGTWGGNVTSENVGPRHLLNIKTVSDRRENMLWFRVPPKIYFKPGCLPIALR
ELAGKKRAFLVTDKPLFDLGITEPIVHTLEELGIKYDIFHEVEPDPTLSTVNRGLGLLRQ
YQPDVIVAVGGGSPMDAAKVMWLLYEHPEVEFDGLAMRFMDIRKRVYQLPPLGQKAILVA
IPTTSGTGSEVTPFAVVTDDRVGIKYPLADYALTPTMAIVDPDLVLHMPKKLTAYGGIDA
LTHALEAYVSVLSTEFTEGLALEAIKLLFTYLPRAYRLGAADPEAREKVHYAATIAGMAF
ANAFLGVCHSLAHKLGSTFHVPHGLANALMISHVIRYNATDAPLKQAIFPQYKYPQAKER
YAQIADFLELGGTTPEEKVERLIAAIEDLKAQLEIPATIKEALNSEDQAFYEQVESMAEL
AFDDQCTGANPRYPLIQDLKELYILAYMGCRRDAAAYYGGEATGS
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccccaaccttgaccagtgacccccccgttcaaagccttgccgatctggaaggg
ctgattgagcgcgtccaacgggcgcagagtcagtacgcccaatttacccaagagcaagtg
gatcacattttccacgaagcagccatggcggccaaccaagcccggattcccctggccaaa
caagccgtagccgaaacgggcatgggggttgtcgaagataaagttattaaaaatcacttt
gcttcggaatacatctacaacaagtacaaaaatgagaaaacctgcggcgtcattgaggat
gaccccatctttggtatccaaaaaattgctgaaccggtggggatcattgccggtgtggtg
ccggtcacgaaccccacttcaacgaccatctttaaggcactgattgccctgaagactcgc
aatggcattatcttttcgccccacccccgggcaaaggcctgtacggttgcagcggccaag
gtagtgttggatgcagcggtcgctgccggcgcaccccccgatattattggctggattgat
gagccgacgattgaactctcccaagccctgatgcagcacccgcagatcaagctgattttg
gccacggggggaccaggtatggtcaaggcagcctattcctctggccatccggcgatcggg
gtcggggccgggaatacccccgtgctcattgatgccacagccgatattcccacggcagtg
agttcgattctcctcagtaaggcctttgacaatggcatgatctgtgcctcggagcaggca
gtgattgttgtggatgagatttatgacgcacttaaagctgagtttcaacggcgaggggcc
taccttctctcccctgaggaacggcagcaggtggcacaactactgctgaaggatggtcgc
ctcaatgccgccattgttggtcaatcggccgccaccattgccgcaatggccaatatccaa
gtaccgccagaaacccgggtactcattggcgaggtgagtgaagtggggccgcaggagcca
ttttcctatgagaaactctgtccggtattggcgttatatcgggcaccccagttccataaa
ggggtggagattgcggcccagttggtgaattttgggggcaaggggcatacatctgtgctc
tataccgatccccgcaatcaagatgatattgcctatttcaaataccgcatgcaaacggcg
cgggttctgattaacaccccttcttcccagggggcaattggcgatctctacaacttcaag
ttagatccgtcgctaacccttggttgtggtacgtggggcggcaacgtcacatcggaaaat
gttggtccccgtcacttgctgaatattaaaacggtgagcgatcgccgggaaaatatgctt
tggtttcgggtgccgcccaagatctacttcaaacccggctgtttgcccattgccctgcgg
gagctggcggggaaaaaacgcgccttcctcgtgacggataaacccctctttgacttgggg
atcactgaaccgattgtccataccctcgaagaactgggcatcaagtatgacatcttccat
gaagtggaaccagatccaaccctcagtaccgttaaccgcggtctagggttgctgcggcaa
tatcagccggatgtgattgttgctgtggggggtggctcacctatggatgcagccaaggtg
atgtggctgttgtatgagcatccggaggtggagtttgacggccttgcgatgcgcttcatg
gatattcgcaagcgggtgtatcaactgcctcccttgggtcaaaaggcaatcctggtggct
attcccaccacctcggggacgggttcagaggtgaccccctttgccgtggttaccgacgat
cgcgtggggattaaatatcccttggcagactatgcccttacgccaacgatggcgattgtg
gatcccgacttggtgctgcacatgcccaagaaactgacggcctacggtggcattgatgcg
ctgacccatgccctggaggcctatgtgtcggtgctctcgacggagtttacggagggactg
gctctagaggccattaaactgctctttacctacctaccccgtgcctatcgcttgggggcg
gcggatccggaggcacgggagaaggtccactatgcggcgacgatcgctggcatggccttt
gcgaatgccttcttgggggtctgccactcgctggcccacaaactaggctccaccttccac
gtgccccacggcttggcgaatgcactcatgatttcccatgtgattcgctacaatgccacg
gatgctcccctgaagcaggcgattttcccgcagtacaagtatccccaagcgaaggagcgc
tatgcccaaattgccgacttcctcgaattggggggcacgaccccagaggaaaaagtggag
cgtctcattgcggcaattgaggatttgaaagcccaattagaaattcccgccacgattaag
gaggccctcaacagtgaggatcaagcgttctatgagcaggtggagagcatggccgaactg
gcctttgacgatcagtgcacgggggccaatccccgctatccgctgatccaagacctcaag
gagttgtatatcctggcctatatggggtgtcggcgggatgcggcagcctactatgggggg
gaggcaacggggagttga

DBGET integrated database retrieval system