KEGG   Thermosynechococcus elongatus: tlr0374Help
Entry
tlr0374           CDS       T00090                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tel  Thermosynechococcus elongatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    tlr0374
Enzymes [BR:tel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     tlr0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
371960..373363
Genome map
AA seq 467 aa AA seqDB search
MIEVDVAIVGGGLSGLSVAWRLQRSAPHYSGVLLEASDRLGGNITTQAAEGFVWELGPNS
FAPTPALLQLIAEVGLHSELIRGDRHLPRYIYWRGELYPLEPTRPLALATSNLLSPWGKV
RAALGALGFVPPYLGSGDESVDSFFRRHLGQEVAERLVAPFVSGVYAGDPQQLSAAAAFR
RIAQLEKLGGSLIAGALRLRRQQPPQPKPPAQVQMRPGELGSFREGLAALPRAIAQQLKA
PLHLQTPVEAITPEPKGGYLLRSGEQTWHARSVVLATPAYQTAELVAPFQPAIARALATI
PYPTVACVVLAYPAGLGRSVRPGFGVLVPRGQGIRTLGTIWSSCLFPQRTPAGWQVFTSF
IGGATDPDLASLREEAIVEQVQQDLTRLLDLPAAKARLLGMKVWRRAIPQYIVGYPQQWQ
QVTHALTQTPGLFLCSNYAEGVALGDRVEHGNRTAAAVAAYLAGGQS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaggtagatgttgcaattgttgggggtggtctcagtggcctcagtgttgcttgg
cggttgcagcggagcgcccctcactacagtggcgttcttttagaggccagcgatcgcctg
gggggcaatatcacgacccaagcggcggagggctttgtctgggaactgggtcccaatagc
tttgcccccacccctgccctcctacaactcattgccgaggtgggcttgcactcagagctc
attcggggcgatcgccacctaccgcgctacatctactggcggggggaactctaccccctc
gaacccacccgtcccctggccttggccacttcaaatttgctcagcccttggggaaaagta
cgggcagcccttggtgccttggggtttgtgcctccctatctgggcagtggggacgagtca
gttgattcatttttccgtcgccatttggggcaagaggttgctgaacgactggtggccccc
tttgtctctggggtttatgccggtgatccgcaacaattgagtgccgctgctgcttttcgt
cgtattgcccaactggaaaaactagggggtagcctcattgccggggctctgcgcctgcgg
cgtcaacaaccccctcaaccaaaaccccctgcacaggtgcaaatgcgaccaggggagctt
ggctcctttagggaaggtttggctgctctgccgcgggcgatcgcccaacaattgaaggca
ccccttcacctgcaaacccctgttgaagcgatcaccccagaacccaagggtggctacctg
ctgcgcagtggtgagcaaacgtggcatgcccgcagtgtggtcttggcaacgcctgcctat
caaaccgcagagttagtcgctcccttccagccagcgatcgcccgtgctttggcgaccatc
ccctatcccaccgtggcctgtgtggtcttggcctaccctgccggactgggacgcagtgta
cgccccggatttggagtactggttcctcgtggtcagggcatccgtaccctgggcaccatt
tggtcgtcctgtctttttccccaacgcacccccgccggttggcaagtcttcaccagtttt
attggcggtgctacggatcccgatttggctagccttagggaagaagcgattgtcgagcaa
gtgcagcaggatttgacccgcctccttgatttacccgcagccaaggcacgattactcggt
atgaaagtttggcgacgggcgattccccaatatattgtgggctaccctcagcagtggcag
caggtgacccatgccctcacccaaacccctgggcttttcctgtgtagtaactatgctgag
ggtgtggccttgggcgatcgcgtcgaacacggcaatcgaaccgctgctgccgtggctgcc
tatcttgcaggaggccagtcctag

DBGET integrated database retrieval system