KEGG   Thermosynechococcus elongatus: tlr0532Help
Entry
tlr0532           CDS       T00090                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tel  Thermosynechococcus elongatus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tel03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
533159..533791
Genome map
AA seq 210 aa AA seqDB search
MFVYLRGTVVGHQSEGGHRCALILEVNGVGYRLLVTSHLLQQYPPRPEVVQIFTHLSIRE
DQMLLYGFASAAERDLFLRLIRVNGVGPQMALSLLDTLPLPELVQAIVSGNTRRLSRAPG
VGHKTAERIALELKAALSAWRQEMGFTTASSGLPSEAVREELELTLLALGYSDREIAAAL
TAVGQTTTLPNNSDPEAWLREAIAWLSANT
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgtctacctcagaggaaccgttgttggccatcaatcggagggtggccatcgctgt
gccctgatcctagaggtcaatggggtcggctatcgcctactggtgacgtcccatctgttg
cagcaatatccgccgcgtcctgaagtggtgcagatttttacccaccttagtatccgtgag
gatcagatgctcctctatggctttgcctcggcagccgagcgggatctctttctccgtttg
atccgtgtcaatggggttgggccgcagatggcgctatcgctgctggatacactgcccttg
ccagagctggtccaggcgattgttagtggcaatactcggcgtcttagccgggcaccgggg
gtgggtcataaaaccgctgagcgcattgccttggaactcaaggccgccctgagtgcttgg
cgacaggaaatgggattcacaacggcttcctctggcctaccctcagaggcggttcgtgaa
gaactggagttaaccctcttggccttgggctatagcgatcgcgagattgcagccgccctc
actgccgtcgggcaaacgaccactctccctaacaatagcgatccagaggcatggctacgg
gaagccattgcatggctaagtgccaatacatag

DBGET integrated database retrieval system