KEGG   Thermosynechococcus elongatus: tlr0532Help
Entry
tlr0532           CDS       T00090                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tel  Thermosynechococcus elongatus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tel00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    tlr0532 (ruvA)
Enzymes [BR:tel01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     tlr0532 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
533159..533791
Genome map
AA seq 210 aa AA seqDB search
MFVYLRGTVVGHQSEGGHRCALILEVNGVGYRLLVTSHLLQQYPPRPEVVQIFTHLSIRE
DQMLLYGFASAAERDLFLRLIRVNGVGPQMALSLLDTLPLPELVQAIVSGNTRRLSRAPG
VGHKTAERIALELKAALSAWRQEMGFTTASSGLPSEAVREELELTLLALGYSDREIAAAL
TAVGQTTTLPNNSDPEAWLREAIAWLSANT
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgtctacctcagaggaaccgttgttggccatcaatcggagggtggccatcgctgt
gccctgatcctagaggtcaatggggtcggctatcgcctactggtgacgtcccatctgttg
cagcaatatccgccgcgtcctgaagtggtgcagatttttacccaccttagtatccgtgag
gatcagatgctcctctatggctttgcctcggcagccgagcgggatctctttctccgtttg
atccgtgtcaatggggttgggccgcagatggcgctatcgctgctggatacactgcccttg
ccagagctggtccaggcgattgttagtggcaatactcggcgtcttagccgggcaccgggg
gtgggtcataaaaccgctgagcgcattgccttggaactcaaggccgccctgagtgcttgg
cgacaggaaatgggattcacaacggcttcctctggcctaccctcagaggcggttcgtgaa
gaactggagttaaccctcttggccttgggctatagcgatcgcgagattgcagccgccctc
actgccgtcgggcaaacgaccactctccctaacaatagcgatccagaggcatggctacgg
gaagccattgcatggctaagtgccaatacatag

DBGET integrated database retrieval system