KEGG   Thermosynechococcus elongatus: tlr0708Help
Entry
tlr0708           CDS       T00090                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tel  Thermosynechococcus elongatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    tlr0708
Enzymes [BR:tel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     tlr0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
725511..727067
Genome map
AA seq 518 aa AA seqDB search
MHFPRSCGLLLHPTSLPGGHGIGELGTAAREFLEFLVASDQQYWQVLPLGPTGFGNSPYM
CYSAMAGNPLLISLEEVAKAGWLTEADLGQITLENRDRVDFDAVISQKLPLLRLAAQRFQ
SQATPGDWQAFRDFQALAHYWLPNYALFMAIKDHHQGQPWYEWPAPLRDREPTALAAIQV
VLKDRIFEYEFQQFLFYQQWHALKEAANQQGIQIIGDIPIYVAHDSVDVWAFPQFFELNP
ETGAAALMAGVPPDYFSATGQLWGNPIYNWKALAADGYSWWIERFRALLAYVDIIRVDHF
RGFQAYWQVPEGEKTAVNGQWQPGPGAAFFEALQAALGRLPILAEDLGDITPDVIALRDQ
FQFPGMKILQFAFGGGSDNPFLPFNQERNCVVYTGTHDNDTTVGWYRNLSNWERQRFIDY
LGYTPSEPHWALIRMALGTVANQAIIPVQDLLGLDSHARMNFPGTDQGNWAWRLTPGQLT
PELAAHLRHLVHLFGRQAPPRPQPGEAEAGTLGMEKQP
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcactttccccgctcctgtggtttactgctccatcccacctcccttcccggcggtcac
ggcattggtgagttgggtaccgctgcccgtgagttcttggaatttttagtggccagtgat
cagcagtactggcaggtgctgcccctaggccccaccggctttggcaattccccctatatg
tgctattcggctatggcgggtaacccactgctgattagcttggaggaagtcgcaaaagcg
ggttggttaacggaggcggatctagggcagattacccttgagaatcgcgatcgcgtggat
ttcgacgctgtgattagccagaagctgccgctcctacgcctggcggcgcaacgtttccag
agtcaggctaccccaggagactggcaggccttccgggacttccaagcccttgcccactac
tggctgcccaactatgccctctttatggcaattaaggaccaccaccagggacagccgtgg
tatgaatggcccgctcctttgcgcgatcgcgagcccaccgcccttgccgctatccaagtg
gttctcaaagaccgcatttttgagtacgaatttcagcaatttctcttttaccagcagtgg
cacgccctcaaggaggccgccaaccaacaggggattcaaattatcggtgatattcccatt
tacgttgcccacgacagtgtagatgtttgggcctttccccaattttttgagctgaatcca
gaaaccggtgccgctgccctgatggccggtgtgcccccggattacttcagtgctacagga
caactctggggcaatcccatttacaactggaaagcccttgcggccgatggctactcttgg
tggattgagcgcttccgtgccctcctcgcctatgtggacattatccgtgtcgatcacttt
cgtggctttcaggcctactggcaagtgccggaaggggagaaaacagctgtcaacggccaa
tggcaaccaggtcctggtgctgccttcttcgaagctttgcaagcggccttgggacgactg
cctattctagcggaggatttgggggatattacccccgatgtcattgccctgcgggatcag
tttcagtttccggggatgaaaattctccagtttgcctttggcggtggttcggataatccg
tttttgccctttaatcaagagcgcaactgtgtggtgtataccggcacccacgacaacgac
acaactgtgggctggtatcgtaacctcagtaactgggaacggcagcgttttattgactat
ttgggctatacccccagcgagccccactgggccttgattcgcatggccttgggaaccgtt
gccaaccaagccattattcccgttcaagacctgctcggcctcgatagccatgcccgcatg
aattttcccggtactgaccaaggcaactgggcgtggcggctgactcctgggcaactcacc
cctgaacttgccgctcatttgaggcacctggtgcacctctttggccgtcaagcgcccccc
agacctcagcctggtgaagccgaggcaggaaccctcggaatggagaagcagccctaa

DBGET integrated database retrieval system