KEGG   Thermosynechococcus elongatus: tlr0966Help
Entry
tlr0966           CDS       T00090                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tel  Thermosynechococcus elongatus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    tlr0966 (tpiA)
   01230 Biosynthesis of amino acids
    tlr0966 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    tlr0966 (tpiA)
   00051 Fructose and mannose metabolism
    tlr0966 (tpiA)
   00562 Inositol phosphate metabolism
    tlr0966 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    tlr0966 (tpiA)
Enzymes [BR:tel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     tlr0966 (tpiA)
Exosome [BR:tel04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   tlr0966 (tpiA)
  Exosomal proteins of bladder cancer cells
   tlr0966 (tpiA)
  Exosomal proteins of melanoma cells
   tlr0966 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
988897..989694
Genome map
AA seq 265 aa AA seqDB search
MIRDNPCGTLDQVKFRRGKSRGVRPKVLAGNWKMHKTQQEAVAFLQEFLGELVDTPSDRE
VVLCVPYTCLSVLSKSLHGTRVKLGAQNVHWADQGAFTGEISPPMLVELGVRYVIIGHSE
RRQYFGETDATVNQRLRAAQSHGLTPILCVGETKAQRAAGETENHIFQQLALDLVDVDQT
NLVIAYEPIWAIGTGDTCEETEANRVIGLIRSQLHNPDVPIQYGGSVNANNIDAIMAQPE
IDGVLVGGASLQPQSFGRIVNYKPL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatcagggataacccgtgtggtacgcttgatcaggttaagtttcgcagaggaaagtca
agaggagtgcgcccaaaagttcttgctggcaactggaaaatgcacaaaacgcaacaggag
gcagtggccttcctacaggagttcttaggggaattggtggacacccccagcgatcgcgag
gtggtgctgtgtgttccctacacctgtttgagtgtattgtctaagagtctgcatggaaca
cgggtgaagctgggggcccaaaatgtccactgggcagatcagggggcgtttacgggggaa
atttccccaccgatgttggtggagctgggggtgcgctacgtcattattggccacagtgag
cggcggcagtattttggtgaaacggatgccacggttaaccagcggctcagggctgcccaa
agccacggcctgacaccgattctctgtgtcggtgaaacgaaagcgcaacgggctgccggc
gaaacagaaaaccacatctttcagcagttggccctggacttggtggatgtggatcaaacc
aatttggtgattgcctacgagcctatttgggcgatcggtaccggtgatacctgtgaagaa
acggaagcaaaccgcgtcattggtttgattcgcagtcagttgcacaatcccgatgtcccc
attcagtacggtggctcagtcaatgcaaacaatattgatgccatcatggcccagccagaa
attgatggggtgctggtgggtggcgccagtttgcagccacagagttttgggcgcattgtt
aattacaagcccctttga

DBGET integrated database retrieval system