KEGG   Thermosynechococcus elongatus: tlr0966Help
Entry
tlr0966           CDS       T00090                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00010  Glycolysis / Gluconeogenesis
tel00051  Fructose and mannose metabolism
tel00562  Inositol phosphate metabolism
tel00710  Carbon fixation in photosynthetic organisms
tel01100  Metabolic pathways
tel01110  Biosynthesis of secondary metabolites
tel01120  Microbial metabolism in diverse environments
tel01130  Biosynthesis of antibiotics
tel01200  Carbon metabolism
tel01230  Biosynthesis of amino acids
Module
tel_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    tlr0966 (tpiA)
   00051 Fructose and mannose metabolism
    tlr0966 (tpiA)
   00562 Inositol phosphate metabolism
    tlr0966 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    tlr0966 (tpiA)
Enzymes [BR:tel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     tlr0966 (tpiA)
Exosome [BR:tel04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   tlr0966 (tpiA)
  Exosomal proteins of bladder cancer cells
   tlr0966 (tpiA)
  Exosomal proteins of melanoma cells
   tlr0966 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1011354
NCBI-ProteinID: NP_681756
CYORF: tlr0966
UniProt: Q8DKA0
Position
988897..989694
Genome map
AA seq 265 aa AA seqDB search
MIRDNPCGTLDQVKFRRGKSRGVRPKVLAGNWKMHKTQQEAVAFLQEFLGELVDTPSDRE
VVLCVPYTCLSVLSKSLHGTRVKLGAQNVHWADQGAFTGEISPPMLVELGVRYVIIGHSE
RRQYFGETDATVNQRLRAAQSHGLTPILCVGETKAQRAAGETENHIFQQLALDLVDVDQT
NLVIAYEPIWAIGTGDTCEETEANRVIGLIRSQLHNPDVPIQYGGSVNANNIDAIMAQPE
IDGVLVGGASLQPQSFGRIVNYKPL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatcagggataacccgtgtggtacgcttgatcaggttaagtttcgcagaggaaagtca
agaggagtgcgcccaaaagttcttgctggcaactggaaaatgcacaaaacgcaacaggag
gcagtggccttcctacaggagttcttaggggaattggtggacacccccagcgatcgcgag
gtggtgctgtgtgttccctacacctgtttgagtgtattgtctaagagtctgcatggaaca
cgggtgaagctgggggcccaaaatgtccactgggcagatcagggggcgtttacgggggaa
atttccccaccgatgttggtggagctgggggtgcgctacgtcattattggccacagtgag
cggcggcagtattttggtgaaacggatgccacggttaaccagcggctcagggctgcccaa
agccacggcctgacaccgattctctgtgtcggtgaaacgaaagcgcaacgggctgccggc
gaaacagaaaaccacatctttcagcagttggccctggacttggtggatgtggatcaaacc
aatttggtgattgcctacgagcctatttgggcgatcggtaccggtgatacctgtgaagaa
acggaagcaaaccgcgtcattggtttgattcgcagtcagttgcacaatcccgatgtcccc
attcagtacggtggctcagtcaatgcaaacaatattgatgccatcatggcccagccagaa
attgatggggtgctggtgggtggcgccagtttgcagccacagagttttgggcgcattgtt
aattacaagcccctttga

DBGET integrated database retrieval system