KEGG   Thermosynechococcus elongatus: tlr0982Help
Entry
tlr0982           CDS       T00090                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tel  Thermosynechococcus elongatus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    tlr0982 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    tlr0982 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    tlr0982 (thrC)
Enzymes [BR:tel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     tlr0982 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1004913..1006211
Genome map
AA seq 432 aa AA seqDB search
MTATLTSTTETAYFTHLKCKECGAEYEPQAIHVCEYCFGPLEVKYDLERLAAAVTRSTIE
AGPKSIWRYRPFLPVTSAEPIDVGTGMTPLIKAQRLARRLGLKHLYIKNDAVNMPTLSFK
DRVVSVALTRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLGTLI
YGPTVMAVEGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGYEVIEQLGWQLPD
HIVAPLASGSLFTKIYKGFREFVAVGLVADKPVRCSGAQAVGCSPIAQAYAEGRDFVAPV
KPNTIAKSIAIGNPADGVYALEIARKTNGAIAAATDEEIVAGIKLLAETEGIFTETAGGT
TIAVLKKLVESGKIDPEEVTVVYITGNGLKTQEAVQNDIGQPLRIEPKLASFERALERSR
TLERLDWQPVLV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaccttgacctccaccaccgaaaccgcctactttacccacctcaaatgcaaa
gagtgtggtgcagagtacgagccccaagcgattcatgtctgtgagtactgttttggcccc
ctagaggtgaagtacgatttggaacgcttggcggcagctgtaacgcgcagcaccattgag
gcaggtccgaagtccatttggcgctaccgtccctttttgccggtgacctcggcagagccc
attgatgtgggcacaggaatgactcccctcatcaaagcgcagcggctggcgcggcggctg
gggctcaagcatctgtacatcaaaaacgatgcggtgaacatgcctaccctcagctttaag
gatcgggtggtatcggtggcgttgacacgggcgcgggaattgggctttacgacagtctcc
tgtgccagtaccggcaatttggcgaattcaacggcggcgatcgcggcccatgcggggcta
gactgctgcgtgtttattccagcggatctggaagcgggtaaggtcttggggacgctcatc
tatgggccaacggtgatggcggttgagggcaactacgatcaggtcaaccgcctctgctcg
gaggtggcaaatacccatggctgggggtttgtcaatatcaatttgcgcccctactattcg
gaagggtcaaagacgctaggttatgaggtgattgagcagttgggctggcaactgcctgac
cacattgtggctcccttggcttctggctctctgttcacgaaaatttacaaaggcttccgg
gaatttgtggcagtgggtctagtggctgacaaacctgtgcgctgtagtggtgcccaagcg
gtcggttgctcccccattgcccaagcctatgccgaggggcgggactttgtggcacccgtg
aagcccaacaccattgctaaatccattgccattggtaaccccgccgatggtgtctatgcc
ttagaaattgcccgcaaaaccaatggggcgatcgctgcggccaccgatgaagaaattgtg
gcaggcattaagctgcttgcggaaacggaagggattttcaccgaaactgctggcggtacc
acaattgctgttctcaaaaagttggtggaatcgggcaaaattgaccccgaagaggtgacc
gtcgtctatatcacgggcaatggcctgaaaacccaagaggcggtacaaaacgatatcggt
caacctttgaggattgaacccaagttggccagctttgagcgcgccctagagcgatcgcgc
accctcgaacggttggattggcaaccggtattggtctag

  All links  
No link information was found.   
DBGET integrated database retrieval system