KEGG   Thermosynechococcus elongatus: tlr0982Help
Entry
tlr0982           CDS       T00090                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00260  Glycine, serine and threonine metabolism
tel00750  Vitamin B6 metabolism
tel01100  Metabolic pathways
tel01110  Biosynthesis of secondary metabolites
tel01120  Microbial metabolism in diverse environments
tel01230  Biosynthesis of amino acids
Module
tel_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    tlr0982 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    tlr0982 (thrC)
Enzymes [BR:tel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     tlr0982 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NinF zinc_ribbon_2
Motif
Other DBs
NCBI-GeneID: 1011342
NCBI-ProteinID: NP_681772
CYORF: tlr0982
UniProt: Q8DK84
Position
1004913..1006211
Genome map
AA seq 432 aa AA seqDB search
MTATLTSTTETAYFTHLKCKECGAEYEPQAIHVCEYCFGPLEVKYDLERLAAAVTRSTIE
AGPKSIWRYRPFLPVTSAEPIDVGTGMTPLIKAQRLARRLGLKHLYIKNDAVNMPTLSFK
DRVVSVALTRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLGTLI
YGPTVMAVEGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGYEVIEQLGWQLPD
HIVAPLASGSLFTKIYKGFREFVAVGLVADKPVRCSGAQAVGCSPIAQAYAEGRDFVAPV
KPNTIAKSIAIGNPADGVYALEIARKTNGAIAAATDEEIVAGIKLLAETEGIFTETAGGT
TIAVLKKLVESGKIDPEEVTVVYITGNGLKTQEAVQNDIGQPLRIEPKLASFERALERSR
TLERLDWQPVLV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaccttgacctccaccaccgaaaccgcctactttacccacctcaaatgcaaa
gagtgtggtgcagagtacgagccccaagcgattcatgtctgtgagtactgttttggcccc
ctagaggtgaagtacgatttggaacgcttggcggcagctgtaacgcgcagcaccattgag
gcaggtccgaagtccatttggcgctaccgtccctttttgccggtgacctcggcagagccc
attgatgtgggcacaggaatgactcccctcatcaaagcgcagcggctggcgcggcggctg
gggctcaagcatctgtacatcaaaaacgatgcggtgaacatgcctaccctcagctttaag
gatcgggtggtatcggtggcgttgacacgggcgcgggaattgggctttacgacagtctcc
tgtgccagtaccggcaatttggcgaattcaacggcggcgatcgcggcccatgcggggcta
gactgctgcgtgtttattccagcggatctggaagcgggtaaggtcttggggacgctcatc
tatgggccaacggtgatggcggttgagggcaactacgatcaggtcaaccgcctctgctcg
gaggtggcaaatacccatggctgggggtttgtcaatatcaatttgcgcccctactattcg
gaagggtcaaagacgctaggttatgaggtgattgagcagttgggctggcaactgcctgac
cacattgtggctcccttggcttctggctctctgttcacgaaaatttacaaaggcttccgg
gaatttgtggcagtgggtctagtggctgacaaacctgtgcgctgtagtggtgcccaagcg
gtcggttgctcccccattgcccaagcctatgccgaggggcgggactttgtggcacccgtg
aagcccaacaccattgctaaatccattgccattggtaaccccgccgatggtgtctatgcc
ttagaaattgcccgcaaaaccaatggggcgatcgctgcggccaccgatgaagaaattgtg
gcaggcattaagctgcttgcggaaacggaagggattttcaccgaaactgctggcggtacc
acaattgctgttctcaaaaagttggtggaatcgggcaaaattgaccccgaagaggtgacc
gtcgtctatatcacgggcaatggcctgaaaacccaagaggcggtacaaaacgatatcggt
caacctttgaggattgaacccaagttggccagctttgagcgcgccctagagcgatcgcgc
accctcgaacggttggattggcaaccggtattggtctag

DBGET integrated database retrieval system