KEGG   Thermosynechococcus elongatus: tlr1228Help
Entry
tlr1228           CDS       T00090                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tel  Thermosynechococcus elongatus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    tlr1228
   01230 Biosynthesis of amino acids
    tlr1228
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    tlr1228
  Energy metabolism
   00680 Methane metabolism
    tlr1228
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    tlr1228
Enzymes [BR:tel01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     tlr1228
Exosome [BR:tel04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   tlr1228
  Exosomal proteins of melanoma cells
   tlr1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1273832..1274446
Genome map
AA seq 204 aa AA seqDB search
MRLILIRHGEAVGNDSGVMLGRQDVPLTERGRQQALALREKLPRPNAIYTSPLQRCHDTA
TLMNPCPDLKIQELAELIEIDQGIFTGLTWAQAQSQHPDLCEELEESDYLIPVPEAESMA
MAWQRAKQAWKQLRRHSDEDCVWCISHGGFLQCLISVVLGSDRLWGMEIPPAAWFDFSVR
VDLDGRFEAENTRWWRIHAFNQFP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttaattttgattcgtcatggagaagctgttggcaatgattcgggcgttatgctt
ggacggcaagatgtgcccctcacagaacggggacggcagcaagcccttgccctgcgggaa
aaactcccccggccgaatgccatttacaccagtccgctgcaacgctgccacgatacggct
acgctgatgaatccctgtcccgacttaaaaattcaagagctagcggagttgattgaaatt
gatcagggaatttttacaggactgacatgggcacaggcccagtcacaacatcctgacctc
tgtgaagaactggaagagagcgattacctgattccagtccccgaagccgagtcaatggcc
atggcttggcagcgggcaaaacaggcttggaaacaactccgacgtcacagtgatgaggac
tgcgtttggtgtattagtcatggcggttttttgcagtgccttattagtgttgtgctgggg
agcgatcgcctctgggggatggagattccccccgctgcttggttcgacttctcagtacgg
gtggatttagatggacgcttcgaagcagaaaatacccgctggtggcgtattcatgccttc
aatcagttcccctag

DBGET integrated database retrieval system