KEGG   Thermosynechococcus elongatus: tlr1228Help
Entry
tlr1228           CDS       T00090                                 

Definition
(RefSeq) phosphoglycerate mutase
Organism
tel  Thermosynechococcus elongatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CYORF: 
UniProt: 
Position
1273832..1274446
Genome map
AA seq 204 aa AA seqDB search
MRLILIRHGEAVGNDSGVMLGRQDVPLTERGRQQALALREKLPRPNAIYTSPLQRCHDTA
TLMNPCPDLKIQELAELIEIDQGIFTGLTWAQAQSQHPDLCEELEESDYLIPVPEAESMA
MAWQRAKQAWKQLRRHSDEDCVWCISHGGFLQCLISVVLGSDRLWGMEIPPAAWFDFSVR
VDLDGRFEAENTRWWRIHAFNQFP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttaattttgattcgtcatggagaagctgttggcaatgattcgggcgttatgctt
ggacggcaagatgtgcccctcacagaacggggacggcagcaagcccttgccctgcgggaa
aaactcccccggccgaatgccatttacaccagtccgctgcaacgctgccacgatacggct
acgctgatgaatccctgtcccgacttaaaaattcaagagctagcggagttgattgaaatt
gatcagggaatttttacaggactgacatgggcacaggcccagtcacaacatcctgacctc
tgtgaagaactggaagagagcgattacctgattccagtccccgaagccgagtcaatggcc
atggcttggcagcgggcaaaacaggcttggaaacaactccgacgtcacagtgatgaggac
tgcgtttggtgtattagtcatggcggttttttgcagtgccttattagtgttgtgctgggg
agcgatcgcctctgggggatggagattccccccgctgcttggttcgacttctcagtacgg
gtggatttagatggacgcttcgaagcagaaaatacccgctggtggcgtattcatgccttc
aatcagttcccctag

DBGET integrated database retrieval system