KEGG   Thermosynechococcus elongatus: tlr1370Help
Entry
tlr1370           CDS       T00090                                 

Definition
dihydroflavonol 4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
tel  Thermosynechococcus elongatus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1436514..1437452
Genome map
AA seq 312 aa AA seqDB search
MAQVLTERGYCVRALVRQPQRADHLKAWDVELVQGDLRTSDLVTLMRGCQVLFHAAAHYS
LWRRDRSLLYAVNVAGTRRILAAAREAGIERTVYTSSVAAIGVDPRGQPTTEAYQSPPEK
LISEYKRSKYWAEQVAHEAISQGQDIVIVNPSTPIGAWDAKPTPTGEIILRFLRRQMPFY
VNTGLNLIHVRDVAIGHLLALEKGKTGERYILGHQNLTLADILGRLAAMTGLPRPLGEIP
IVIPLGVAWLDEVVLGALGKPPAIPLDGVRMAQQKMFYDARKAVAELGLPQTPIDQALRD
AVTWYRERGYCP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaggtgctcacagagagggggtattgcgtccgtgccctggtgcggcaaccgcag
cgggcggatcatctcaaggcatgggatgtggagctggtgcaaggggatttaaggacgagt
gacctcgtcaccttgatgcgggggtgccaagtgctcttccatgctgcagcccactacagt
ctgtggcggcgcgatcgctcccttctctatgccgttaatgtggccggcacccgtcgcatc
ttggccgctgcccgtgaggctggtattgagcgcacggtttacaccagttctgtcgccgcc
attggggttgatcccaggggccaacccaccaccgaagcctaccaaagcccccccgaaaaa
ctgatcagcgagtacaagcgctccaagtactgggcagagcaagtggctcacgaggcaatc
tcccagggccaagatattgtgattgtcaaccccagtacccccattggtgcctgggatgca
aagcccacccctacgggtgaaatcatcctgcgctttttacggcgacagatgcccttttac
gtcaacacgggactgaacctgatccatgtgcgggacgtggcgatcggtcatcttttggcc
ttagaaaaaggcaaaaccggtgaacgctacatcctcggtcaccaaaacctaacgctggcg
gacattctaggacgattagctgcgatgactgggctgccccgcccccttggcgaaattccc
attgtgattcccttaggggtggcttggttggatgaagtagtgttgggggctttgggcaaa
ccacccgcgattcccttggatggggtgcggatggcacagcaaaaaatgttttacgatgcc
cgcaaagctgtggctgaattgggcttgccccagacgccgattgatcaggcactgcgggac
gccgtgacttggtaccgcgaacggggctactgcccctag

DBGET integrated database retrieval system