KEGG   Thermosynechococcus elongatus: tlr2355Help
Entry
tlr2355           CDS       T00090                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tel  Thermosynechococcus elongatus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    tlr2355
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    tlr2355
   00052 Galactose metabolism
    tlr2355
   00500 Starch and sucrose metabolism
    tlr2355
   00520 Amino sugar and nucleotide sugar metabolism
    tlr2355
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    tlr2355
   00524 Butirosin and neomycin biosynthesis
    tlr2355
Enzymes [BR:tel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     tlr2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2456345..2457241
Genome map
AA seq 298 aa AA seqDB search
MSEPYVIGVDLGGTAIKMGRFSPKGDCLNALTLPTPQPPFPERVIKAILQGIQDLDGEDQ
ALAIGMGIPGPVDASGRIARRAINLDWYEVPISDSLEHLTGKPTVIGNDANCAGLGEAWL
GAGNQFKDLILLTLGTGVGGAIILNGELFVGRDGTAGELGLITLDYNGPPCNSGNRGSLE
QHVSAQALRRRWGCEPHEMAERAKNGDPEAIALWQTYGRELAAGIASLVYVLTPEAVIIG
GGISAASDLFFPSMIAELEERVLPTSRHHLQCLRATLGNSAGIVGAAKLAWQHVKEHL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaccctacgttattggcgttgatctcggtggcacggccatcaaaatggggcgc
tttagtcccaagggggactgcctcaatgccctgacgttgccgactcctcagccccctttt
ccagaacgggtgatcaaagcaattttgcaggggattcaagacctggatggtgaggatcag
gcattggcgattggtatgggcataccggggcctgtggatgccagcggtcgcattgcccgc
cgtgccattaaccttgactggtacgaagtgccgattagcgatagcctggaacacctgacg
ggcaaacccacagtgattggtaacgatgccaactgcgccggcctcggagaagcatggcta
ggagcagggaatcagttcaaagacttaattttgctcacattggggacgggggtagggggt
gccattatcctcaatggggagttgttcgttggtcgagatggcaccgccggcgagttgggg
ctgattaccctcgactacaacgggcctccctgcaacagtggcaatcgcggttccctggag
caacacgtttccgcccaagccctgcggcggcgttggggctgtgaaccccatgagatggca
gagcgggccaaaaatggcgatcctgaggcgatcgccctctggcaaacctatggccgcgaa
ttagccgctggcattgctagccttgtgtatgtgctcaccccggaagcagtgattattggc
ggggggataagtgccgccagtgatctcttctttccctcgatgattgctgaattggaggag
cgggtgctgcccacctcccgtcatcacctccagtgtttgcgagcaacccttgggaattcc
gcaggcatcgtcggtgcagccaaactggcatggcaacatgtgaaagagcatctctaa

DBGET integrated database retrieval system