KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0085Help
Entry
TepRe1_0085       CDS       T01495                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00900  Terpenoid backbone biosynthesis
tep01100  Metabolic pathways
tep01110  Biosynthesis of secondary metabolites
tep01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TepRe1_0085
Enzymes [BR:tep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TepRe1_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEE90297
UniProt: F4LRN4
Position
96112..96966
Genome map
AA seq 284 aa AA seqDB search
MKKLDIDARGKINLTLDVLFKRLDGYHEVEMIMQTIALKDIISIELLSRRDIVLNTNCKK
LPQDESNLAYQAAELMMKEYELDAGVSIDIHKNIPLAAGLAGGSSDAAAVIIGINELFEL
KIPKDELMTLGERIGADVPFCILGKTAFARGIGEQLTPLKSLSGLSILLVKPPYCISTKE
VYNRLDVKNIKIRPDTKAMIDYIEHQDIDKIASGLCNVLEEVTIRLYPELGDIKKRMLEK
GALGSVMSGSGPSVFGIFENIRDAKRAADDFAGTDNWIFVTKTE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaattggatatagatgcaaggggcaagataaacttgacccttgatgtgcttttt
aaaagacttgacggctaccatgaagttgaaatgattatgcagacaattgcattaaaggat
ataatctcgatagaattactttcacgtcgtgatatagttttaaacacaaattgcaaaaaa
ctgcctcaagatgaaagcaatctggcttaccaagctgccgagctcatgatgaaagaatat
gagcttgatgctggggtgtcaatcgatatacacaaaaacatcccattggcggcaggactg
gcaggaggcagttcagatgcggcagcggttattataggtataaatgagctttttgagtta
aaaatacctaaggacgagttaatgactttgggagaaagaatcggtgcagatgtacctttt
tgtattttgggcaaaaccgcttttgcacgcggcataggtgaacaactgactcctttaaaa
tccctatcgggccttagcatacttcttgtaaaaccaccatattgcatttctacaaaagag
gtatacaatagactggatgtaaaaaacataaaaatccgaccagatacaaaagctatgata
gattatatagagcatcaggatatcgataaaatagcttcaggcctttgcaatgtcttggaa
gaagttacgataagactttatcctgagcttggcgatataaaaaaacgcatgttagaaaaa
ggagcattgggcagtgttatgtcgggcagcggacccagtgttttcggcatttttgaaaat
attcgggatgccaaaagagcggctgatgattttgcaggtacagataactggatttttgtg
accaaaacggaatga

DBGET integrated database retrieval system