KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0148Help
Entry
TepRe1_0148       CDS       T01495                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TepRe1_0148
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TepRe1_0148
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TepRe1_0148
Enzymes [BR:tep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TepRe1_0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
163774..165123
Genome map
AA seq 449 aa AA seqDB search
MEDTKILLKESEIPTSWYNIQADMPTPVKPPLSPVTGKPATPEELGAIFPEEIIKQEVST
ERFIEIPEEVQKLYRLWRPSPVYRAHRLEKALDTPAGIYFKYEGVSPAGSHKLNTAIPQA
YYNKKQGIRRLATETGAGQWGTALSMACKFFDMECSVYMVKVSYEQKPYRRSIMQLFGAE
VFASPTDKTDAGRAVLKEHPDSLGSLGIAISEAVEDAVKNSDTNYALGSVLNHVVLHQTV
IGLEAKKQMEKAGYYPDVVIACSGGGSNFGGIAMPFVHDKIKDGKKTRIIAAEPAACPSL
TKGKFTYDYGDVAHLTPKMMMYTLGSDFVPPGIHAGGLRYHGASPIQSQLLHDELIEAVA
YDQQDIFEAAMLFAQNEGIVPAPESAHAIKAAIDEALKAKEAGEKKTILFNLSGHGYFDM
ASYDNYLSGKLQNSSLSDDVLQETLSKLQ
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggaagatacaaaaatattacttaaggaaagcgaaattccaacaagctggtataatatt
caggcagatatgccgactcctgtaaaaccgccgcttagccctgttacagggaagcctgcg
acgcctgaggagctaggggcaatattccctgaagaaatcataaaacaagaagtaagtaca
gagcgttttatagaaatacccgaggaagttcaaaagttatacagattgtggaggccgtcg
cccgtctatagagcacacaggctggaaaaggctttagatacgcctgccgggatttacttt
aagtatgaaggagtgagtcccgccggcagtcataagttaaataccgccattcctcaggcc
tattataataaaaaacaggggataaggcggctggccaccgaaacaggtgcagggcagtgg
ggaacagcactttctatggcttgcaagttctttgacatggaatgctcggtttacatggtg
aaggtaagttatgagcaaaagccctatcggcgctcaataatgcagcttttcggagcagag
gtgtttgcaagccccaccgataaaaccgatgcgggccgtgccgtgctaaaagagcatccg
gattccttaggaagcttaggtattgcaataagtgaagcggtggaagatgccgtaaaaaat
tctgatacgaactatgctttaggcagtgtattaaaccacgtagttcttcaccaaacagtc
attggtcttgaagctaaaaaacaaatggaaaaagcaggctactatccggatgtggtaata
gcctgttccggcggcggcagcaattttggcggaattgccatgccatttgtgcacgataaa
atcaaagacggcaaaaaaacacgtataatcgcagctgagcctgccgcctgtccaagtctt
acaaagggcaagttcacttacgattatggcgatgtggcccatttgactccaaagatgatg
atgtataccttgggaagcgattttgttccaccgggaatccacgcaggaggcttgcgctac
catggagcatctccaatccaaagccagcttttgcatgatgagctgattgaggctgttgct
tatgaccagcaggatatttttgaagcagcgatgctttttgcacaaaatgaaggaattgtg
ccggcacctgaatcagctcatgctataaaagcagcaatcgatgaagccttaaaagccaaa
gaagccggagaaaaaaagacaattttgtttaacttgagcggtcatggatatttcgacatg
gcatcttacgacaattatctttccggcaagctgcaaaactccagcctgtctgatgatgtc
ttgcaggaaaccttaagtaaactacagtaa

DBGET integrated database retrieval system