KEGG   Tepidanaerobacter sp. Re1: TepRe1_0254Help
Entry
TepRe1_0254       CDS       T01495                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tep  Tepidanaerobacter sp. Re1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tep00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:tep00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
268868..270103
Genome map
AA seq 411 aa AA seqDB search
MNYKLLLIIIVLSIVVVYGCESYNNQAVKDQDHIIDQDADIVDPLKEQIAQMTIDEKVGQ
MVMVGLEGYEKDQYSQEMIEKYKVGGFIFFERNIRDAYQTLTLINSLKEANKENAIPLFI
AVDEEGGRVTRMPEEFIKLPASRLIGRINNEELCFKIGNVIGEELKSLGFNMNFAPVLDI
DSNPANPVIGDRSFSSNEQTVSKLGTATMKGIQTNVISAVKHFPGHGDTSTDSHIGLPVV
NCDLERLKSFELVPFASAVENGADMVMVAHILLPEIDEENPATLSKSIITDILRSEMKFD
KVVITDDMTMGAITENFDIGDAAVKSIMAGADIILVCHDHEKQVKVLEALKQAAVDGIIT
EDELDMHIYRILKLKQKYNLNDEKIESVDVEKINEKIRDILGKDFCALKFL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaattataagttattacttatcataatagtattgtcaatagtagtagtatatggctgc
gaaagctataataaccaagcagtaaaagaccaagatcacatcattgaccaagatgctgat
attgttgatccgttaaaagaacagattgcacagatgacaatagatgagaaagtgggccag
atggtcatggtaggtcttgaaggatatgaaaaagaccaatattctcaggaaatgatagag
aaatacaaagttggaggattcatattttttgaacgaaatataagggatgcctatcagaca
ttgactcttataaactcattaaaggaagcaaataaagaaaatgcaattccacttttcatt
gccgttgatgaggaaggcggaagggtcacccggatgccggaggaatttataaaactgcct
gcaagcagacttattggcagaataaacaatgaggagctttgctttaaaatcggaaacgtc
ataggtgaagaactaaaatcgctgggctttaatatgaattttgcaccggttttagatata
gacagcaatccggcaaatcctgtcataggcgataggtcttttagctctaatgagcaaaca
gtcagtaaactaggtactgccactatgaagggaatccaaaccaatgtaatctcagcagtc
aaacactttcccggccatggagatacatcgacagattctcatataggactgcctgttgta
aattgtgatttagaaaggcttaaaagttttgaacttgtgccttttgccagtgccgtagaa
aacggtgcggatatggtgatggtggcgcacatattactacctgagattgatgaagaaaac
cccgctacgctttcaaaaagtataataaccgatattttaagatccgaaatgaaatttgac
aaagttgtaattactgatgatatgacgatgggggcaataacggaaaatttcgatataggt
gatgcagcagtgaaatcaataatggcaggagcggatattatccttgtgtgtcatgatcat
gaaaagcaggtaaaagtcttggaggcattaaaacaggcggcggtagacgggattattacc
gaagatgagcttgatatgcatatatacaggatattaaagttaaaacaaaaatacaattta
aacgatgagaagatagagtcagtggatgtagaaaagataaatgaaaaaatcagagatatt
ttaggaaaggacttttgtgcccttaagtttctttaa

DBGET integrated database retrieval system