KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0254Help
Entry
TepRe1_0254       CDS       T01495                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TepRe1_0254
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TepRe1_0254
Enzymes [BR:tep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TepRe1_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
268868..270103
Genome map
AA seq 411 aa AA seqDB search
MNYKLLLIIIVLSIVVVYGCESYNNQAVKDQDHIIDQDADIVDPLKEQIAQMTIDEKVGQ
MVMVGLEGYEKDQYSQEMIEKYKVGGFIFFERNIRDAYQTLTLINSLKEANKENAIPLFI
AVDEEGGRVTRMPEEFIKLPASRLIGRINNEELCFKIGNVIGEELKSLGFNMNFAPVLDI
DSNPANPVIGDRSFSSNEQTVSKLGTATMKGIQTNVISAVKHFPGHGDTSTDSHIGLPVV
NCDLERLKSFELVPFASAVENGADMVMVAHILLPEIDEENPATLSKSIITDILRSEMKFD
KVVITDDMTMGAITENFDIGDAAVKSIMAGADIILVCHDHEKQVKVLEALKQAAVDGIIT
EDELDMHIYRILKLKQKYNLNDEKIESVDVEKINEKIRDILGKDFCALKFL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaattataagttattacttatcataatagtattgtcaatagtagtagtatatggctgc
gaaagctataataaccaagcagtaaaagaccaagatcacatcattgaccaagatgctgat
attgttgatccgttaaaagaacagattgcacagatgacaatagatgagaaagtgggccag
atggtcatggtaggtcttgaaggatatgaaaaagaccaatattctcaggaaatgatagag
aaatacaaagttggaggattcatattttttgaacgaaatataagggatgcctatcagaca
ttgactcttataaactcattaaaggaagcaaataaagaaaatgcaattccacttttcatt
gccgttgatgaggaaggcggaagggtcacccggatgccggaggaatttataaaactgcct
gcaagcagacttattggcagaataaacaatgaggagctttgctttaaaatcggaaacgtc
ataggtgaagaactaaaatcgctgggctttaatatgaattttgcaccggttttagatata
gacagcaatccggcaaatcctgtcataggcgataggtcttttagctctaatgagcaaaca
gtcagtaaactaggtactgccactatgaagggaatccaaaccaatgtaatctcagcagtc
aaacactttcccggccatggagatacatcgacagattctcatataggactgcctgttgta
aattgtgatttagaaaggcttaaaagttttgaacttgtgccttttgccagtgccgtagaa
aacggtgcggatatggtgatggtggcgcacatattactacctgagattgatgaagaaaac
cccgctacgctttcaaaaagtataataaccgatattttaagatccgaaatgaaatttgac
aaagttgtaattactgatgatatgacgatgggggcaataacggaaaatttcgatataggt
gatgcagcagtgaaatcaataatggcaggagcggatattatccttgtgtgtcatgatcat
gaaaagcaggtaaaagtcttggaggcattaaaacaggcggcggtagacgggattattacc
gaagatgagcttgatatgcatatatacaggatattaaagttaaaacaaaaatacaattta
aacgatgagaagatagagtcagtggatgtagaaaagataaatgaaaaaatcagagatatt
ttaggaaaggacttttgtgcccttaagtttctttaa

DBGET integrated database retrieval system